ProGP297 (FlaB (Flagellin))
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP297 (FlaB (Flagellin)) |
Validation Status | Characterized |
Organism Information | |
Organism Name | Aeromonas caviae Sch3N strain |
Domain | Bacteria |
Classification | Phylum : Proteobacteria Class : Gammaproteobacteria Orders : Aeromonadales Family : Aeromonadaceae Genus : Aeromonas Species : punctata Strain : Sch3N strain |
Taxonomic ID (NCBI) | 648 |
Genome Information | |
GenBank | AF198617 |
EMBL | AF198617 |
Gene Information | |
Gene Name | flaB |
Protein Information | |
Protein Name | FlaB (Flagellin) |
UniProtKB/SwissProt ID | Q9R9R8 |
UniProtKB Sequence | >tr|Q9R9R8|Q9R9R8_AERCA Flagellin OS=Aeromonas caviae GN=flaB PE=3 SV=1 MAMYINTNTSSLNAQRNLMNTSKSMDTSYTRLASGLRINSAKDDAAGLQISNRLTSQING LDQGNRNANDGISLAQTAEGAMDEVTGMLQRMRTLAQQSANGSNSDKDRAALQKEVNQLG AEINRISKDTTFAGTKLLDGNYSGKFQVGADANQTIGFSLSQAGGFSISGIAKAAGTTID IVSGPAGSVTTATGISLIFVSGSAGGISISTQSKAQAVLAAADAMLEVVDGKRAELGAVQ NRLDSTIRNQANISENVSAARSRIRDANFATETANMTKHNILQQAASSILAQANQRPQSA LQLLG |
Function | Polar flagellin, Glycosylation helps in motility of the bacterium. |
Glycosylation Status | |
Glycosylation Type | O- (Ser/Thr) linked |
Experimentally Validated Glycosite(s) in Full Length Protein | T155, S159, S161, S167, S169 |
Technique(s) used for Glycosylation Detection | Collision-induced dissociation MS/MS (CID), Western Blotting |
Technique(s) used for Glycosylated Residue(s) Detection | Collision-induced dissociation MS/MS (CID), Western Blotting |
Glycan Information | |
Glycan Annotation | Six to eight Pse5Ac7Ac (pseudaminic acid) residues found in S/T-rich domain spanning residues 146 to 232. |
Literature | |
Year of Identification | 2009 |
Year of Identification Month Wise | 2009.2.13 |
Reference | Tabei, S.M.B., Hitchen, P.G., Day-Williams, M.J., Merino, S., Vart, R., Pang, P.C., Horsburgh, G.J., Viches, S., Wilhelms, M., Tomás, J.M. and Dell, A., 2009. An Aeromonas caviae genomic island is required for both O-antigen lipopolysaccharide biosynthesis and flagellin glycosylation. Journal of bacteriology, 191(8), pp.2851-2863. |
Corresponding Author | Jonathan G Shaw |
Contact | Unit of Infection and Immunity, School of Medicine and Biomedical Sciences, University of Sheffield, Sheffield S10 2RX, United Kingdom. |
Reference | Lowry, R.C., Allihaybi, L., Parker, J.L., Couto, N.A., Stafford, G.P. and Shaw, J.G., 2022. Heterogeneous glycosylation and methylation of the Aeromonas caviae flagellin. MicrobiologyOpen, 11(4), p.e1306. |
Corresponding Author | Jonathan G. Shaw Graham P. Stafford |
Contact | Department of Infection Immunity and Cardiovascular Disease, University of Sheffield Medical School, Sheffield, UK School of Clinical Dentistry, Claremont Crescent, University of Sheffield, Sheffield, UK |