ProGP297 (FlaB (Flagellin))
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP297 (FlaB (Flagellin)) |
| Validation Status | Uncharacterized |
| Organism Information | |
| Organism Name | Aeromonas caviae Sch3N strain |
| Domain | Bacteria |
| Classification | Family: Aeromonadaceae Order: Aeromonadales Class: Gammaproteobacteria Division or phylum: "Proteobacteria" |
| Taxonomic ID (NCBI) | 648 |
| Genome Information | |
| GenBank | AF198617 |
| EMBL | AF198617 |
| Gene Information | |
| Gene Name | flaB |
| Protein Information | |
| Protein Name | FlaB (Flagellin) |
| UniProtKB/SwissProt ID | Q9R9R8 |
| UniProtKB Sequence | >tr|Q9R9R8|Q9R9R8_AERCA Flagellin OS=Aeromonas caviae GN=flaB PE=3 SV=1 MAMYINTNTSSLNAQRNLMNTSKSMDTSYTRLASGLRINSAKDDAAGLQISNRLTSQING LDQGNRNANDGISLAQTAEGAMDEVTGMLQRMRTLAQQSANGSNSDKDRAALQKEVNQLG AEINRISKDTTFAGTKLLDGNYSGKFQVGADANQTIGFSLSQAGGFSISGIAKAAGTTID IVSGPAGSVTTATGISLIFVSGSAGGISISTQSKAQAVLAAADAMLEVVDGKRAELGAVQ NRLDSTIRNQANISENVSAARSRIRDANFATETANMTKHNILQQAASSILAQANQRPQSA LQLLG |
| Function | Polar flagellin |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser/Thr) linked |
| Glycan Information | |
| Glycan Annotation | Six to eight Pse5Ac7Ac (pseudaminic acid) residues found in S/T-rich domain spanning residues 146 to 232. |
| Literature | |
| Year of Identification | 2009 |
| Year of Identification Month Wise | 2009.2.13 |
| Reference | Tabei, S.M.B., Hitchen, P.G., Day-Williams, M.J., Merino, S., Vart, R., Pang, P.C., Horsburgh, G.J., Viches, S., Wilhelms, M., Tomás, J.M. and Dell, A., 2009. An Aeromonas caviae genomic island is required for both O-antigen lipopolysaccharide biosynthesis and flagellin glycosylation. Journal of bacteriology, 191(8), pp.2851-2863. |
| Corresponding Author | Jonathan G Shaw |
| Contact | Unit of Infection and Immunity, School of Medicine and Biomedical Sciences, University of Sheffield, Sheffield S10 2RX, United Kingdom. |
| Reference | Lowry, R.C., Allihaybi, L., Parker, J.L., Couto, N.A., Stafford, G.P. and Shaw, J.G., 2022. Heterogeneous glycosylation and methylation of the Aeromonas caviae flagellin. MicrobiologyOpen, 11(4), p.e1306. |
| Corresponding Author | Jonathan G. Shaw Graham P. Stafford |
| Contact | Department of Infection Immunity and Cardiovascular Disease, University of Sheffield Medical School, Sheffield, UK School of Clinical Dentistry, Claremont Crescent, University of Sheffield, Sheffield, UK |
| Reference | Tabei SM, Hitchen PG, Day-Williams MJ, Merino S, Vart R, Pang PC, Horsburgh GJ, Viches S, Wilhelms M, Tomás JM, Dell A, Shaw JG. (2009) An Aeromonas caviae genomic island is required for both O-antigen lipopolysaccharide biosynthesis and flagellin glycosylation. J Bacteriol., 191(8):2851-63. |
| Author | Tabei SM, Hitchen PG, Day-Williams MJ, Merino S, Vart R, Pang PC, Horsburgh GJ, Viches S, Wilhelms M, Tomás JM, Dell A, Shaw JG |
| Research Group | Unit of Infection and Immunity, School of Medicine and Biomedical Sciences, University of Sheffield, Sheffield S10 2RX, United Kingdom. |
| Corresponding Author | Shaw JG |
| Contact | Unit of Infection and Immunity, School of Medicine and Biomedical Sciences, University of Sheffield, Sheffield S10 2RX, United Kingdom. |