ProGP338 (FTH_1293)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP338 (FTH_1293) |
| Validation Status | Uncharacterized |
| Organism Information | |
| Organism Name | Francisella tularensis ssp. holarctica strain FSC200 |
| Domain | Bacteria |
| Classification | Family: Francisellaceae Order:Thiotrichales Class: Gammaproteobacteria Division or phylum: "Proteobacteria" |
| Taxonomic ID (NCBI) | 351581 |
| Genome Information | |
| GenBank | CP003862.1 |
| EMBL | CP003862.1 |
| Gene Information | |
| Gene Name | FTH_1293 |
| GenBank Gene Sequence | NC_008369.1 |
| Protein Information | |
| Protein Name | FTH_1293 |
| NCBI RefSeq | WP_043023490.1 |
| EMBL-CDS | ABI83137.1 |
| UniProtKB Sequence | >WP_043023490.1 OmpA family protein [Francisella tularensis] MRLKSIVIATTVLLGSATASIAAGSDNIDTSANSNSATTQSSGFAANNFIAPFANTYSALTNKDNTWGPQ DRTGQWYLGVDANGLAGTPNSPSGAGANFTIGYNINKYFAVQYNQLVGRVFAGLGEGVVNFSNNTMFTPY AAGGAGWANLAGQATGAWDVGGGLKFELSRNVQASVDYRYIQTMAPSNISGANGRAGTNMIGAGLTWFFG GKDTTNNDTGNIQDNGATTAAQTVAMPTIDESKYVLPAGIKQCEGNFNLTEDGVACYTVNGDDVTVYLDT KFAYDKATLNAKGKKAIASFVNFIKDSNISSVTVKGYASQGQTGSEFDIYNQKLSEKRAQAVADYMKQLG LDSEKIITKGFGYNDTLGGIHKSDPRNQRVEASVSAPLKEAN |
| Sequence length | 392 AA |
| Subcellular Location | Outer Membrane |
| Function | Outer membrane protein FopA |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser/Thr) linked |
| Technique(s) used for Glycosylation Detection | Hydrazide labeling, lectin blotting and lectin affinity chromatography |
| Literature | |
| Year of Identification | 2010 |
| Year of Identification Month Wise | 2010.4.5 |
| Reference | Balonova, L., Hernychova, L., Mann, B.F., Link, M., Bilkova, Z., Novotny, M.V. and Stulik, J., 2010. Multimethodological approach to identification of glycoproteins from the proteome of Francisella tularensis, an intracellular microorganism. Journal of proteome research, 9(4), pp.1995-2005. |
| Corresponding Author | Lenka Hernychova |
| Contact | Institute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic |
| Reference | Balonova, L., Mann, B.F., Cerveny, L., Alley, W.R., Chovancova, E., Forslund, A.L., Salomonsson, E.N., Forsberg, Å., Damborsky, J., Novotny, M.V. and Hernychova, L., 2012. Characterization of protein glycosylation in Francisella tularensis subsp. holarctica: identification of a novel glycosylated lipoprotein required for virulence. Molecular & Cellular Proteomics, 11(7), pp.M111-015016. |
| Corresponding Author | Lenka Hernychova |
| Contact | Institute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic |
| Reference | Balonova L, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J. (2010) Multimethodological approach to identification of glycoproteins from the proteome of Francisella tularensis, an intracellular microorganism. J Proteome Res., 9, 1995-2005. [PMID: 20175567] |
| Author | Balonova L, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J. |
| Research Group | Institute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic |
| Corresponding Author | Stulik J. |
| Contact | Institute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic |
| Reference | Balonova L, Mann BF, Cerveny L, Alley WR Jr, Chovancova E, Forslund AL, Salomonsson EN, Forsberg A, Damborsky J, Novotny MV, Hernychova L, Stulik J. (2012) Characterization of protein glycosylation in Francisella tularensis subsp. holarctica: identification of a novel glycosylated lipoprotein required for virulence. Mol Cell Proteomics, 11(7), M111.015016. [PubMed: 22361235] |
| Author | Lucie Balonova, Benjamin F. Mann, Lukas Cerveny, William R. Alley, Jr.,Eva Chovancova , Anna-Lena Forslund, Emelie N. Salomonsson, Åke Forsberg, Jiri Damborsky , Milos V. Novotny, Lenka Hernychova, and Jiri Stulik. |
| Research Group | Institute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, 500 01 Hradec Kralove, Czech Republic. |
| Corresponding Author | Jiri Stulik. |
| Contact | Institute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, 500 01 Hradec Kralove, Czech Republic. |