ProGP338 (FTH_1293)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP338 (FTH_1293)
Validation Status Uncharacterized
Organism Information
Organism NameFrancisella tularensis ssp. holarctica strain FSC200
Domain Bacteria
Classification Family: Francisellaceae
Order:Thiotrichales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 351581
Genome Information
GenBank CP003862.1
EMBL CP003862.1
Gene Information
Gene NameFTH_1293
GenBank Gene Sequence NC_008369.1
Protein Information
Protein NameFTH_1293
NCBI RefSeq WP_043023490.1
EMBL-CDSABI83137.1
UniProtKB Sequence >WP_043023490.1 OmpA family protein [Francisella tularensis] MRLKSIVIATTVLLGSATASIAAGSDNIDTSANSNSATTQSSGFAANNFIAPFANTYSALTNKDNTWGPQ DRTGQWYLGVDANGLAGTPNSPSGAGANFTIGYNINKYFAVQYNQLVGRVFAGLGEGVVNFSNNTMFTPY AAGGAGWANLAGQATGAWDVGGGLKFELSRNVQASVDYRYIQTMAPSNISGANGRAGTNMIGAGLTWFFG GKDTTNNDTGNIQDNGATTAAQTVAMPTIDESKYVLPAGIKQCEGNFNLTEDGVACYTVNGDDVTVYLDT KFAYDKATLNAKGKKAIASFVNFIKDSNISSVTVKGYASQGQTGSEFDIYNQKLSEKRAQAVADYMKQLG LDSEKIITKGFGYNDTLGGIHKSDPRNQRVEASVSAPLKEAN
Sequence length 392 AA
Subcellular LocationOuter Membrane
Function Outer membrane protein FopA
Glycosylation Status
Glycosylation Type O- (Ser/Thr) linked
Technique(s) used for Glycosylation DetectionHydrazide labeling, lectin blotting and lectin affinity chromatography
Literature
Year of Identification2010
Year of Identification Month Wise2010.4.5
ReferenceBalonova, L., Hernychova, L., Mann, B.F., Link, M., Bilkova, Z., Novotny, M.V. and Stulik, J., 2010. Multimethodological approach to identification of glycoproteins from the proteome of Francisella tularensis, an intracellular microorganism. Journal of proteome research, 9(4), pp.1995-2005.
Corresponding Author Lenka Hernychova
ContactInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic
ReferenceBalonova, L., Mann, B.F., Cerveny, L., Alley, W.R., Chovancova, E., Forslund, A.L., Salomonsson, E.N., Forsberg, Å., Damborsky, J., Novotny, M.V. and Hernychova, L., 2012. Characterization of protein glycosylation in Francisella tularensis subsp. holarctica: identification of a novel glycosylated lipoprotein required for virulence. Molecular & Cellular Proteomics, 11(7), pp.M111-015016.
Corresponding Author Lenka Hernychova
ContactInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic
ReferenceBalonova L, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J. (2010) Multimethodological approach to identification of glycoproteins from the proteome of Francisella tularensis, an intracellular microorganism. J Proteome Res., 9, 1995-2005. [PMID: 20175567]
AuthorBalonova L, Hernychova L, Mann BF, Link M, Bilkova Z, Novotny MV, Stulik J.
Research GroupInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic
Corresponding Author Stulik J.
ContactInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, Hradec Kralove, Czech Republic
Reference Balonova L, Mann BF, Cerveny L, Alley WR Jr, Chovancova E, Forslund AL, Salomonsson EN, Forsberg A, Damborsky J, Novotny MV, Hernychova L, Stulik J. (2012) Characterization of protein glycosylation in Francisella tularensis subsp. holarctica: identification of a novel glycosylated lipoprotein required for virulence. Mol Cell Proteomics, 11(7), M111.015016. [PubMed: 22361235]
Author Lucie Balonova, Benjamin F. Mann, Lukas Cerveny, William R. Alley, Jr.,Eva Chovancova , Anna-Lena Forslund, Emelie N. Salomonsson, Åke Forsberg, Jiri Damborsky , Milos V. Novotny, Lenka Hernychova, and Jiri Stulik.
Research GroupInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, 500 01 Hradec Kralove, Czech Republic.
Corresponding Author Jiri Stulik.
ContactInstitute of Molecular Pathology, Faculty of Military Health Sciences, University of Defence, 500 01 Hradec Kralove, Czech Republic.