ProGP400 (Sublancin)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP400 (Sublancin) |
Validation Status | Characterized |
Organism Information | |
Organism Name | Bacillus subtilis 168 |
Domain | Bacteria |
Classification | Family: Bacillaceae Order: Bacillales Class: Bacilli (or Firmibacteria) Division or phylum: "Firmicutes" |
Taxonomic ID (NCBI) | 1423 |
Genome Information | |
GenBank | AF014938.1 |
EMBL | AF014938 |
Gene Information | |
Gene Name | sunA |
NCBI Gene ID | 939121 |
GenBank Gene Sequence | NC_000964.3 |
Protein Information | |
Protein Name | Sublancin |
UniProtKB/SwissProt ID | P68577 |
NCBI RefSeq | NP_390031.1 |
EMBL-CDS | AAC63531.1 |
UniProtKB Sequence | >sp|P68577|SUNA_BACSU SPBc2 prophage-derived bacteriocin sublancin-168 OS=Bacillus subtilis GN=sunA PE=1 SV=1 MEKLFKEVKLEELENQKGSGLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR |
Sequence length | 56 AA |
Subcellular Location | Secreted |
Function | SP? prophage-derived bacteriocin sublancin-168. It has antimicrobial activity against Gram-positive bacteria. It is stable at both low and high pH and lacks free thiols. |
Protein Structure | |
PDB ID | 2MIJ |
Glycosylation Status | |
Glycosylation Type | S- (Cys) linked |
Experimentally Validated Glycosite(s) in Full Length Protein | (Propeptide: 1-19) C41 |
Experimentally Validated Glycosite(s ) in Mature Protein | C22 |
Glycosite(s) Annotated Protein Sequence | >sp|P68577|SUNA_BACSU SPBc2 prophage-derived bacteriocin sublancin-168 OS=Bacillus subtilis GN=sunA PE=1 SV=1 MEKLFKEVKLEELENQKGSGLGKAQCAALWLQCASGGTIGC*(41)GGGAVACQNYRQFCR |
Sequence Around Glycosites (21 AA) | LQCASGGTIGCGGGAVACQNY |
Technique(s) used for Glycosylation Detection | Higher mass observed using mass spectrometry |
Technique(s) used for Glycosylated Residue(s) Detection | Tandem ESI-MS (electrospray ionization quadrupole-TOF mass spectrometry) analysis after chymotrypsin digestion. |
Protein Glycosylation- Implication | Glucosylation is essential for its bioactivity. |
Glycan Information | |
Glycan Annotation | UDP-Glc, UDP-GlcNAc, UDP-Gal, GDP-Man and UDP-Xyl can serve as substrates for SunS GTase but UDP-?-D-glucose is most efficiently used. |
Technique(s) used for Glycan Identification | GC-MS (gas chromatography-mass spectrometry) analysis after trimethylsilylation |
Protein Glycosylation linked (PGL) gene(s) | |
OST ProGT ID | ProGT46 (SunS) |
Literature | |
Reference | Oman, T.J., Boettcher, J.M., Wang, H., Okalibe, X.N. and van der Donk, W.A. (2011) Sublancin is not a lantibiotic but an S-linked glycopeptide. Nat Chem Biol, 7, 78-80. [PubMed: 21196935] |
Author | Oman, T.J., Boettcher, J.M., Wang, H., Okalibe, X.N. and van der Donk, W.A. |
Research Group | Department of Chemistry, University of Illinois at Urbana-Champaign, Urbana, Illinois, USA |
Corresponding Author | van der Donk, W.A. |
Contact | Department of Chemistry, University of Illinois at Urbana-Champaign, Urbana, Illinois, USA |
Reference | Stepper, J., Shastri, S., Loo, T.S., Preston, J.C., Novak, P., Man, P., Moore, C.H., Havlicek, V., Patchett, M.L. and Norris, G.E. (2011) Cysteine S-glycosylation, a new post-translational modification found in glycopeptide bacteriocins. FEBS Lett, 585, 645-650. [PubMed: 21251913] |
Author | Stepper, J., Shastri, S., Loo, T.S., Preston, J.C., Novak, P., Man, P., Moore, C.H., Havlicek, V., Patchett, M.L. and Norris, G.E. |
Research Group | Institute of Molecular Biosciences, Massey University, Palmerston North, New Zealand. |
Corresponding Author | Norris, G.E. |
Contact | Institute of Molecular Biosciences, Massey University, Palmerston North, New Zealand. |
Reference | Wang H, van der Donk WA (2011) Substrate selectivity of the sublancin S-glycosyltransferase. J Am Chem Soc. 133 (41), 16394-7. [PubMed: 21910430] |
Author | Wang H, van der Donk WA |
Research Group | Howard Hughes Medical Institute and Roger Adams Laboratory, Department of Chemistry, University of Illinois at Urbana-Champaign, 600 South Mathews Avenue, Urbana, Illinois 61801, USA. |
Corresponding Author | Wilfred A. van der Donk |
Contact | Howard Hughes Medical Institute and Roger Adams Laboratory, Department of Chemistry, University of Illinois at Urbana-Champaign, 600 South Mathews Avenue, Urbana, Illinois 61801, USA |
Reference | Garcia De Gonzalo CV, Zhu L, Oman TJ, van der Donk WA (2-14) NMR structure of the S-linked glycopeptide sublancin 168. ACS Chem Biol. 9(3):796-801. [PubMed: 24405370] |
Author | Garcia De Gonzalo CV, Zhu L, Oman TJ, van der Donk WA |
Research Group | Howard Hughes Medical Institute and Roger Adams Laboratory, Department of Chemistry, University of Illinois at Urbana-Champaign , 600 South Mathews Avenue, Urbana, Illinois 61801, United States. |
Corresponding Author | Wilfred A. van der Donk |
Contact | Howard Hughes Medical Institute and Roger Adams Laboratory, Department of Chemistry, University of Illinois at Urbana-Champaign, 600 South Mathews Avenue, Urbana, Illinois 61801, USA |