ProGP401 (Plantaricin ASM1)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP401 (Plantaricin ASM1) |
| Validation Status | Characterized |
| Organism Information | |
| Organism Name | Lactobacillus plantarum A-1 |
| Domain | Bacteria |
| Classification | Phylum : Firmicutes Class : Bacilli Orders : Lactobacillales Family : Lactobacillaceae Genus : Lactobacillus Species : plantarum Strain : A-1 |
| Taxonomic ID (NCBI) | 1590 |
| Genome Information | |
| GenBank | AB474371 |
| EMBL | AB474371 |
| Gene Information | |
| Gene Name | bactA1 |
| Protein Information | |
| Protein Name | Plantaricin ASM1 |
| UniProtKB/SwissProt ID | C7G1H4 |
| EMBL-CDS | BAH98036.1 |
| UniProtKB Sequence | >sp|C7G1H4|PASM1_LACPL Bacteriocin plantarican ASM1 OS=Lactobacillus plantarum GN=bactA1 PE=1 SV=1 MSKLVKTLTVDEISKIQTNGGKPAWCWYTLAMCGAGYDSGTCDYMYSHCFGVKHSSGGGG SYHC |
| Sequence length | 64 AA |
| Subcellular Location | Secreted |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser) linked |
| Experimentally Validated Glycosite(s) in Full Length Protein | (Signal peptide: 1-21) S61 |
| Experimentally Validated Glycosite(s ) in Mature Protein | S40 |
| Glycosite(s) Annotated Protein Sequence | >sp|C7G1H4|PASM1_LACPL Bacteriocin plantarican ASM1 OS=Lactobacillus plantarum GN=bactA1 PE=1 SV=1 MSKLVKTLTVDEISKIQTNGGKPAWCWYTLAMCGAGYDSGTCDYMYSHCFGVKHSSGGGG S*(61)YHC |
| Sequence Around Glycosites (21 AA) | GVKHSSGGGGSYHC |
| Technique(s) used for Glycosylation Detection | Difference between the theoretical and measured masses |
| Technique(s) used for Glycosylated Residue(s) Detection | Edman sequencing |
| Literature | |
| Year of Identification | 2011 |
| Year of Identification Month Wise | 2011.5.20 |
| Year of Validation | 2011 |
| Reference | Stepper, J., Shastri, S., Loo, T.S., Preston, J.C., Novak, P., Man, P., Moore, C.H., Havlíček, V., Patchett, M.L. and Norris, G.E., 2011. Cysteine S-glycosylation, a new post-translational modification found in glycopeptide bacteriocins. FEBS letters, 585(4), pp.645-650. |
| Corresponding Author | Gillian E. Norris |
| Contact | Institute of Molecular Biosciences, Massey University, Palmerston North, New Zealand. |
| Reference | Main, P., Hata, T., Loo, T.S., Man, P., Novak, P., Havlíček, V., Norris, G.E. and Patchett, M.L., 2020. Bacteriocin ASM1 is an O/S‐diglycosylated, plasmid‐encoded homologue of glycocin F. FEBS letters, 594(7), pp.1196-1206. |
| Corresponding Author | G. E. Norris |
| Contact | School of FundamentalSciences, Massey University Manawatu,Private Bag 11 222, Palmerston North 4442,New Zealand |