ProGP413 (Putative Uncharacterized Protein)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP413 (Putative Uncharacterized Protein) |
Validation Status | Uncharacterized |
Organism Information | |
Organism Name | Acinetobacter baumannii ATCC 17978 |
Domain | Bacteria |
Classification | Family: Moraxellaceae Order: Pseudomonadales Class: Gammaproteobacteria Division or phylum: "Proteobacteria" |
Taxonomic ID (NCBI) | 400667 |
Genome Information | |
GenBank | CP000521.1 |
EMBL | CP018664.1 |
Organism Additional Information | Acinetobacter baumannii is an opportunistic nosocomial pathogen infecting immunocompromised patients. It causes pneumonia, septicaemia, urinary tract infections and meningitis. There has been a rise in the multidrug-resistant as well as pandrug-resistant strains of the ?superbug?. |
Gene Information | |
Gene Name | A1S_0556 |
GenBank Gene Sequence | CP000521.1 |
Protein Information | |
Protein Name | Putative Uncharacterized Protein |
NCBI RefSeq | ABO11009 |
EMBL-CDS | ABO11009.1 |
UniProtKB Sequence | >ABO11009.2 hypothetical protein A1S_0556 [Acinetobacter baumannii ATCC 17978] MLTSKASLHLTLLASAIFLVACQPKSDPKESEDQQKPAVVEQKPVELTLKGETVPSKVTLPDCDGKTCPE FTVERLQSNFPFIDKIIDQQVLKALGQILEIAEPDAKAAQADKKTEASAAATTEQQDSFDAQVQRYANSF IDLDNELKALSSNHQINLLVKPKIIQSQGKVVTVVVNSSSYLGGAHGSAAQQYYNFDLKKEKQVKLEDLL RPEKKAALEKLAHEAFKAWVTDSKLANSVSEYEQAWPFKLTENFLLGDQGLILQYGEYEIGPYVVGLPRL VIPYDQLQEVLKEEYLPQPKAKPASTPAVKSAS |
Sequence length | 313 AA |
Subcellular Location | Membrane |
Function | Unknown |
Glycosylation Status | |
Glycosylation Type | O- (Ser/Thr) linked |
Technique(s) used for Glycosylation Detection | ZIC HILIC and Mass spectrometry (LTQ-Orbitrap Velos) |
Glycan Information | |
Glycan Annotation | Pentasaccharide β-GlcNAc3NAcA4OAc-4-(β-GlcNAc-6-)-α-Gal-6-β-Glc-3-β-GalNAc-S/T. β-GlcNAc3NAcA4OAcA is an O-acetylated derivative of glucuronic acid. |
GlyTouCan | G09064NU |
Technique(s) used for Glycan Identification | 1H:13C HSQC 2D NMR and mass spectrometry |
Protein Glycosylation linked (PGL) gene(s) | |
OST Gene Name | PglLAb |
OST ProGT ID | ProGT55 (PglLAb) |
Literature | |
Reference | Iwashkiw, J.A., Seper, A., Weber, B.S., Scott, N.E., Vinogradov, E., Stratilo, C., Reiz, B., Cordwell, S.J., Whittal, R., Schild, S. and Feldman, M.F., 2012. Identification of a general O-linked protein glycosylation system in Acinetobacter baumannii and its role in virulence and biofilm formation. PLoS pathogens, 8(6), p.e1002758. |
Corresponding Author | Mario F Feldman |
Contact | Alberta Glycomics Centre, Department of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada |
Reference | Iwashkiw JA, Seper A, Weber BS, Scott NE, Vinogradov E, Stratilo C, Reiz B, Cordwell SJ, Whittal R, Schild S, Feldman MF. (2012) Identification of a general O-linked protein glycosylation system in Acinetobacter baumannii and its role in virulence and biofilm formation. PLoS Pathog., 8(6):e1002758. [PubMed: 22685409] |
Author | Iwashkiw JA, Seper A, Weber BS, Scott NE, Vinogradov E, Stratilo C, Reiz B, Cordwell SJ, Whittal R, Schild S, Feldman MF. |
Research Group | Alberta Glycomics Centre, Department of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada |
Corresponding Author | Feldman MF. |
Contact | Alberta Glycomics Centre, Department of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada |