ProGP428 (Protease)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP428 (Protease)
Validation Status Characterized
Organism Information
Organism NameSulfolobus solfataricus P2 (DSM 1617)
Domain Archaea
Classification Family: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI) 273057
Genome Information
GenBank AE006641
EMBL AE006641.1
Gene Information
Gene NameSSO2045
NCBI Gene ID 27428373
GenBank Gene Sequence NZ_LT549890.1
Protein Information
Protein NameProtease
UniProtKB/SwissProt ID Q97WS1
NCBI RefSeq WP_010923751.1
EMBL-CDSAAK42231.1
UniProtKB Sequence >tr|Q97WS1|Q97WS1_SULSO Protease OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2045 PE=4 SV=1 MRLLKILLLAMLILPLFSFFTLSISLYDQIQLPPHYLFYISENATQGSGIDVIFYTSSPI TFMIMTPSQFYQFNQTGSSQSIYSITTNSLSKFFPLSGQYYIVFYNNISNNPVTLNYYIL TRPLPTGIADYGLKINNGVISPYIEKIKSVIGAVEINKLLAYNSTPPAGVSQYSASIQLN VVLQVNTIGGSQQLWLQNVIQIYTNNDSYIFLDNIWNFTGKISILSNSTVKGNGIVYVTN NGNDYYAYGTNFSTLLIPSLKYLLINTSYTSQGPMISFGYMNQSGSPIWYDNVTILIPNT LSAYILVDGYNFTAGGLAYDAELILGGGGNGEFTFFNESNVELAMIYQYLNGTLAPPKFL FPFGLDTEESADNLYSISYNGVYLVSSGYQVINNLNENVSQLRFNVVNYTKATDQNFPYI FTINVSGGVLPYKLNVTISNSSGNELSGYTYVLFPSVSTYYLFLSPLSPGNYTVKIKLTD FNGNSKSYEFSLTINPPLKVQILNVTNYIDLALPYFNFTSIISGGTKPYNIIITISNDSG ILSETYKIINYTSITYYAVNMKGYSIGKYTIQIEVEDYAGSINISKYNFTINPNPYISTL SYTSETDKGLREVIKAIGKGGSGSLIYYWYVNNSLVSSGIGDELYNFTPSNIGEYNITVM VKDVLGVSSAKSVIIKVNPDPVVELSVPKTTIDSGAEFPVNATVSLGTPPYYISWYINGS YVGNESIKELNLSSIGVYIITVTVRDSAGYIINMSKPVLIVPPPSLSVKEQTQGNFIQYN TSIALSASVNGGTDPYYLIFLNGKLVGNYSSTTQLQFKLQNGENNITLIAKDLWGKTAVK TLIVNSGYNYVGIGIIAGIILIIVIVVILVISKRK
Sequence length 875 AA
Subcellular LocationMembrane
Function Peptidase activity
Glycosylation Status
Glycosylation Type N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length ProteinN227, N282, N780 and N825
Glycosite(s) Annotated Protein Sequence >tr|Q97WS1|Q97WS1_SULSO Protease OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2045 PE=4 SV=1 MRLLKILLLAMLILPLFSFFTLSISLYDQIQLPPHYLFYISENATQGSGIDVIFYTSSPI TFMIMTPSQFYQFNQTGSSQSIYSITTNSLSKFFPLSGQYYIVFYNNISNNPVTLNYYIL TRPLPTGIADYGLKINNGVISPYIEKIKSVIGAVEINKLLAYNSTPPAGVSQYSASIQLN VVLQVNTIGGSQQLWLQNVIQIYTN*(227)NDSYIFLDNIWNFTGKISILSNSTVKGNGIVYVTN NGNDYYAYGTNFSTLLIPSLKYLLINTSYTSQGPMISFGYMN*(282)QSGSPIWYDNVTILIPNT LSAYILVDGYNFTAGGLAYDAELILGGGGNGEFTFFNESNVELAMIYQYLNGTLAPPKFL FPFGLDTEESADNLYSISYNGVYLVSSGYQVINNLNENVSQLRFNVVNYTKATDQNFPYI FTINVSGGVLPYKLNVTISNSSGNELSGYTYVLFPSVSTYYLFLSPLSPGNYTVKIKLTD FNGNSKSYEFSLTINPPLKVQILNVTNYIDLALPYFNFTSIISGGTKPYNIIITISNDSG ILSETYKIINYTSITYYAVNMKGYSIGKYTIQIEVEDYAGSINISKYNFTINPNPYISTL SYTSETDKGLREVIKAIGKGGSGSLIYYWYVNNSLVSSGIGDELYNFTPSNIGEYNITVM VKDVLGVSSAKSVIIKVNPDPVVELSVPKTTIDSGAEFPVNATVSLGTPPYYISWYINGS YVGNESIKELNLSSIGVYIITVTVRDSAGYIINMSKPVLIVPPPSLSVKEQTQGNFIQYN*(780) TSIALSASVNGGTDPYYLIFLNGKLVGNYSSTTQLQFKLQNGENN*(825)ITLIAKDLWGKTAVK TLIVNSGYNYVGIGIIAGIILIIVIVVILVISKRK
Sequence Around Glycosites (21 AA) NFTGKISILSNSTVKGNGIVY
QGPMISFGYMNQSGSPIWYDN
EQTQGNFIQYNTSIALSASVN
LQFKLQNGENNITLIAKDLWG
ProGP Web Logo
Technique(s) used for Glycosylation DetectionConcanavalin A lectin affinity chromatography
Glycan Information
Glycan Annotation Branched sulfated heptasaccharide, Hex4(GlcNAc)2 plus sulfoquinovose where Hex is D-mannose and D-glucose.
Literature
Year of Identification2013
Year of Identification Month Wise2013.6.1
Year of Validation 2013
ReferenceSchulz BL, Jen FE, Power PM, Jones CE, Fox KL, Ku SC, Blanchfield JT, Jennings MP. (2013) Identification of bacterial protein O-oligosaccharyltransferases and their glycoprotein substrates. PLoS One, 8(5):e62768. [PubMed: 23658772]
AuthorGianna Palmieri, Marco Balestrieri, Jasna Peter-Katalinic?, Gottfried Pohlentz, Mose? Rossi, Immacolata Fiume, and Gabriella Pocsfalvi
Research GroupInstitute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.
Corresponding Author Gabriella Pocsfalvi
ContactInstitute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.