Home
ProGPdb
Search
Example Display Page
ProGTdb
Search
Example Display Page
Search By Features
Organism
Gene
Donor
Protein
Glycan
Mechanism
Year
Structure Gallery
Crystal Structure
ProGP
ProGT
ProGT Accessory
Homology Model
ProGP
ProGT
Links
Related Reviews
Related Tools & Databases
Bibliography ProGlycProt
GlycoPP V2.0 (beta launch)
Contact Us
Update (2022 release) in progress
ProGP429 (Maltose ABC transporter)
Home
-> ProGPdb ->
Search ProGP
-> Display data
Compare ID
ProGP429 (Maltose ABC transporter)
ProGP471 (Putative uncharacterized protein)
ProGP459 (ABC-type amino acid transport system secreted component)
ProGP458 (ThuA)
ProGP457 (LppO (Putative lipoprotein))
ProGP456 (Rv3835)
ProGP455 (35kDa protein)
ProGP454 (Rv1887)
ProGP453 (Probable conserved MCE associated membrane protein)
ProGP452 (Probable conserved proline rich membrane protein (MT2222))
ProGP460 (Putative protein)
ProGP461 (Putative uncharacterized protein)
ProGP462 (Putative uncharacterized protein)
ProGP470 (Putative uncharacterized protein)
ProGP469 (MdtA multidrug resistance protein)
ProGP468 (C-terminal protease)
ProGP467 (Alanine and proline-rich secreted protei
ProGP466 (Putative protein)
ProGP465 (Immunogenic protein MPT63)
ProGP464 (Putative protein)
ProGP463 (Immunogenic protein MPT63)
ProGP451 (COK_1394)
ProGP450 (AtaC)
ProGP438 (DnaK)
ProGP437 (FliC (Type B Flagellin))
ProGP436 (Acm2)
ProGP435 (FasC (fasciclin domain protein))
ProGP434 (Arabinose ABC transporter, arabinose binding protein (AraS))
ProGP433 (Hypothetical protein)
ProGP432 (Hypothetical protein)
ProGP431 (Hypothetical protein)
ProGP439 (Lp_2260)
ProGP440 (Lp_2162)
ProGP441 (Lp_1643)
ProGP449 (PsrP (Adhesin))
ProGP448 (MOMP)
ProGP447 (FtsZ)
ProGP446 (Lp_3421)
ProGP445 (FtsK1)
ProGP444 (Lp_ 2793)
ProGP443 (FtsY)
ProGP442 (PdhC)
ProGP430 (Serine protease)
ProGP472 (Putative signal peptide)
ProGP514 (EmaA)
ProGP502 (Uncharacterized protein)
ProGP501 (Uncharacterized protein)
ProGP500 (Uncharacterized protein)
ProGP499 (Uncharacterized protein)
ProGP498 (Uncharacterized protein)
ProGP497 (Putative secretion protein)
ProGP496 (PliA)
ProGP495 (EF-P)
ProGP503 (Uncharacterized protein)
ProGP504 (Uncharacterized protein)
ProGP505 (Laz (lipid-modified azurin))
ProGP513 (Knh)
ProGP512 (Enterocin F4-9)
ProGP511 (Translation elongation factor P (EF-P))
ProGP510 (Translation elongation factor P (EF-P))
ProGP509 (Ccop)
ProGP508 (Mip (Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA))
ProGP507 (Sco)
ProGP506 (MetQ)
ProGP494 (FliC (Flagellin))
ProGP493 (CN)
ProGP481 (CpxP-like protein)
ProGP480 (Putative fusaric acid resistance transporter protein)
ProGP479 (Putative lipoprotein)
ProGP478 (Putative uncharacterized protein)
ProGP477 (Putative cell division related protein)
ProGP476 (Putative MCE (mammalian cell entry) related protein)
ProGP475 (Putative uncharacterized protein)
ProGP474 (Putative phospholipid-binding lipoprotei
ProGP482 (ComEA)
ProGP483 (Putative PRC barrel containing lipoprote
ProGP484 (Putative exported protein)
ProGP492 (Type IV Pilin)
ProGP491 (Putative uncharacterized protein)
ProGP490 (OmpA family protein)
ProGP489 (Cell division protein)
ProGP488 (OmlA)
ProGP487 (OM lipoprotein carrier LolA)
ProGP486 (Putative membrane protein)
ProGP485 (oprM efflux system outer membrane protein)
ProGP473 (Peptidoglycan-binding membrane protein)
ProGP429 (Maltose ABC transporter)
ProGP385 (Cj0983 (Putative lipoprotein))
ProGP373 (Putative periplasmic protein)
ProGP372 (Putative periplasmic protein)
ProGP371 (Putative secreted protease)
ProGP370 (Putative exporting protein)
ProGP369 (Putative membrane protein)
ProGP368 (Colicin V production protein)
ProGP367 (Putative uncharacterized protein)
ProGP366 (UPF0323 lipoprotein Cj0371)
ProGP374 (Putative integral membrane protein)
ProGP375 (Putative OmpA family membrane protein)
ProGP376 (Putative outer membrane efflux protein)
ProGP384 (Cj0982c (Putative amino acid transporter periplasmic solute-binding protein CjaA))
ProGP383 (Uncharacterized metallophosphoesterase)
ProGP382 (Putative secreted transglycosylase)
ProGP381 (Cj0783 (Periplasmic nitrate reductase small subunit))
ProGP380 (Putative periplasmic protein)
ProGP379 (Cj0652 (Penicillin-binding protein))
ProGP378 (Putative membrane protein)
ProGP377 (Putative periplasmic protein)
ProGP365 (Cj0366c (Inner membrane multidrug efflux system protein CmeB))
ProGP364 (Putative integral membrane protein)
ProGP352 (Putative cell division protein)
ProGP351 (BF0810)
ProGP350 (TF2339)
ProGP349 (TF1259)
ProGP348 (TfsB (S-layer protein))
ProGP347 (Spermidine/putrescine-binding protein (PotD))
ProGP346 (Chondroitinase ABC)
ProGP345 (Mfa1 (67 kDa minor fimbrillin))
ProGP353 (Putative exported protein)
ProGP354 (Putative non-specific DNA-binding protein)
ProGP355 (Cj0017c (Disulfide bond formation protein))
ProGP363 (Cj0277 (Rod shape-determining protein))
ProGP362 (Putative sulfatase family protein)
ProGP361 (Putative mechanosensitive ion channel family protein)
ProGP360 (Cj0235c (Putative protein export protein))
ProGP359 (Putative membrane protein)
ProGP358 (Putative membrane protein)
ProGP357 (Putative lipoprotein)
ProGP356 (Cj0081 (Cytochrome bd oxidase subunit I))
ProGP344 (SlaA (S-layer protein))
ProGP386 (Putative mechanosensitive ion channel family protein)
ProGP428 (Protease)
ProGP416 (Putative Uncharacterized Protein)
ProGP415 (Putative Uncharacterized Protein)
ProGP414 (Putative Uncharacterized Protein)
ProGP413 (Putative Uncharacterized Protein)
ProGP412 (OmpA/MotB)
ProGP411 (FTL_1096)
ProGP410 (DsbA)
ProGP409 (FliC (Flagellin))
ProGP417 (Putative Uncharacterized Protein)
ProGP418 (Putative Uncharacterized Protein)
ProGP419 (PilA)
ProGP427 (Hypothetical protein)
ProGP426 (Oligopeptide binding protein)
ProGP425 (ABC Transporter (TreS))
ProGP424 (Dipeptide ABC transporter, periplasmic dipeptide binding protein (dppA))
ProGP423 (AniA)
ProGP422 (LafA (Lateral flagellin))
ProGP421 (FlaB (Polar flagellin))
ProGP420 (FlaA (Polar flagellin))
ProGP408 (FliC (Flagellin))
ProGP407 (EhaJ (autotranporter))
ProGP395 (Cj1565c (Paralyzed flagellum protein))
ProGP394 (Cj1444c (Capsule polysaccharide export system periplasmic protein))
ProGP393 (Putative integral membrane protein)
ProGP392 (Putative periplasmic protein)
ProGP391 (Cj1126c (Oligosaccharyltransferase))
ProGP390 (Putative sulfatase protein)
ProGP389 (Putative integral membrane protein)
ProGP388 (Cj1032 (Membrane fusion component multidrug efflux system))
ProGP396 (Putative periplasmic protein)
ProGP397 (Possible ABC transport system permease)
ProGP398 (Lectin LecB)
ProGP406 (TF1056)
ProGP405 (TF0091)
ProGP404 (FlaB (Flagellin))
ProGP403 (FlaA (Flagellin))
ProGP402 (Glycocin F)
ProGP401 (Plantaricin ASM1)
ProGP400 (Sublancin)
ProGP399 (TfsA (S-layer protein))
ProGP387 (Putative cytochrome c biogenesis protein)
ProGP642 (Cytochrome c assembly protein)
ProGP630 (Hypothetical protein)
ProGP629 (ATPase)
ProGP628 (ABC transporter substrate binding protein)
ProGP627 (Hypothetical protein)
ProGP626 (Serpin)
ProGP625 (Hypothetical protein)
ProGP624 (Branched chain amino acid ABC transporter substrate binding protein)
ProGP623 (Hypothetical protein)
ProGP631 (ABC transporter)
ProGP632 (ABC transporter substrate binding protein)
ProGP633 (Hypothetical protein)
ProGP641 (Hypothetical protein)
ProGP640 (Primosomal protein)
ProGP639 (ABC transporter periplasmic binding protein)
ProGP638 (Excisionase)
ProGP637 (Cytochrome c biogenesis protein)
ProGP636 (NosD)
ProGP635 (TRAP ABC transporter)
ProGP634 (Peptide ABC transporter permease)
ProGP622 (NADH-ubiquinone oxidoreductase)
ProGP621 (Sugar binding protein)
ProGP609 (Hypothetical protein)
ProGP608 (Sugar ABC transporter substrate binding protein)
ProGP607 (Geranylgeranyl reductase)
ProGP606 (ABC transporter substrate binding protein)
ProGP605 (Hypothetical protein branched chain amino acid ABC transporter substrate binding protein
ProGP604 (Iron ABC transporter substrate binding protein)
ProGP603 (ABC transporter substrate binding protein)
ProGP602 (FAD-dependent oxidoreductase)
ProGP610 (Hypothetical protein)
ProGP611 (Phosphate starvation protein PhoH)
ProGP612 (ABC transporter)
ProGP620 (Hypothetical protein)
ProGP619 (Hypothetical protein)
ProGP618 (Hypothetical protein)
ProGP617 (Nodulation efficiency protein NfeD)
ProGP616 (NADH dehydrogenase subunit D)
ProGP615 (Hypothetical protein)
ProGP614 (Glutamate dehydrogenase)
ProGP613 (Nitrous oxidase accessory protein)
ProGP601 (Transglutaminase)
ProGP643 (Glycosyltransferase)
ProGP685 (Cnm)
ProGP673 (FHA domain containing protein)
ProGP672 (Hypothetical protein)
ProGP671 (Hypothetical protein)
ProGP670 (Hypothetical protein)
ProGP669 (ABC transporter)
ProGP668 (Hypothetical protein)
ProGP667 (V-type ATP synthase subunit E)
ProGP666 (ABC transporter)
ProGP674 (Hypothetical protein)
ProGP675 (Hypothetical protein)
ProGP676 (Hypothetical protein)
ProGP684 (WpaA)
ProGP683 (Flagellin)
ProGP682 (Flagellin)
ProGP681 (Formate dehydrogenase)
ProGP680 (Peptidase S8)
ProGP679 (Nitrate reductase alpha subunit)
ProGP678 (Hypothetical protein)
ProGP677 (Hypothetical protein)
ProGP665 (ABC transporter)
ProGP664 (V-type ATPase subunit D)
ProGP652 (Amino acid ABC transporter substrate binding protein)
ProGP651 (4Fe-4S ferredoxin)
ProGP650 (Hypothetical protein)
ProGP649 (Transcriptional regulator)
ProGP648 (Nitrate reductase)
ProGP647 (Hypothetical protein)
ProGP646 (Glycosyltransferase)
ProGP645 (ABC transporter substrate binding protein)
ProGP653 (Hypothetical protein)
ProGP654 (SCO1/SenC)
ProGP655 (Hypothetical protein)
ProGP663 (Protein disulfide isomerase like protein)
ProGP662 (30S ribosomal protein S2)
ProGP661 (Eight cysteine cluster domain containing protein)
ProGP660 (Hypothetical protein)
ProGP659 (Hypothetical protein)
ProGP658 (Hypothetical protein)
ProGP657 (Transcriptional regulator)
ProGP656 (RNA methyltransferase)
ProGP644 (Hypothetical protein)
ProGP600 (Hypothetical protein)
ProGP556 (Arabinase)
ProGP544 (Flagellin A2)
ProGP543 (Flagellin A1)
ProGP542 (Translation elongation factor P (EF-P))
ProGP541 (FtsL)
ProGP540 (Probable peptidase transmembrane protein)
ProGP539 (PilA)
ProGP538 (Probable transmembrane protein)
ProGP537 (Peptidyl-prolyl cis-trans isomerase)
ProGP545 (Pilin A1)
ProGP546 (Pilin A2)
ProGP547 (Pilin A3)
ProGP555 (Hypothetical protein)
ProGP554 (Hypothetical protein)
ProGP553 (Hypothetical protein)
ProGP552 (Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96)
ProGP551 (Pls (Plasmin sensitive surface protein))
ProGP550 (Pls (Plasmin sensitive surface protein))
ProGP549 (Pilin A6)
ProGP548 (Pilin A4)
ProGP536 (Probable transmembrane protein)
ProGP535 (Probable lipoprotein)
ProGP523 (Probable lipoprotein transmembrane)
ProGP522 (Putative membrane fusion protein)
ProGP521 (EF-P)
ProGP520 (Hag flagellin)
ProGP519 (Slg2 (S-layer glycoprotein))
ProGP518 (Slg1 (S-layer glycoprotein))
ProGP517 (CcoP)
ProGP516 (C5)
ProGP524 (Probable transmembrane protein)
ProGP525 (Hypothetical signal peptide protein)
ProGP526 (RagB)
ProGP534 (PilN)
ProGP533 (Probable m20-related peptidase)
ProGP532 (Probable serine protease protein)
ProGP531 (Probable transmembrane protein)
ProGP530 (D-(−)-3-hydroxybutyrate oligomer hydrolase)
ProGP529 (AcrA)
ProGP528 (FtsN)
ProGP527 (Probable tpr domain signal peptide protein)
ProGP515 (NirK)
ProGP557 (Hypothetical protein)
ProGP599 (Hypothetical protein)
ProGP587 (Chloride channel protein)
ProGP586 (Hypothetical protein)
ProGP585 (Hypothetical protein)
ProGP584 (Hypothetical protein)
ProGP583 (ATP synthase subunit A)
ProGP582 (Metallophosphoesterase)
ProGP581 (Cytochrome c assembly)
ProGP580 (Histidine kinase)
ProGP588 (Hypothetical protein)
ProGP589 (Thermosome subunit)
ProGP590 (Hypothetical protein)
ProGP598 (Peptidase M50)
ProGP597 (Hypothetical protein)
ProGP596 (Nitrate reductase beta subunit)
ProGP595 (Glycosyl transferase)
ProGP594 (ABC transporter substrate binding protei
ProGP593 (Hypothetical protein)
ProGP592 (Peptidase)
ProGP591 (Peptide ABC transporter substrate bindin protein)
ProGP579 (Hypothetical protein)
ProGP578 (Cytochrome c biogenesis protein)
ProGP566 (Multidrug RND transporter)
ProGP565 (Peptide binding protein)
ProGP564 (Hypothetical protein)
ProGP563 (Pullulanase)
ProGP562 (Hypothetical protein)
ProGP561 (Hypothetical protein)
ProGP560 (Hypothetical protein)
ProGP559 (Pullulanase)
ProGP567 (Molybdopterin oxidoreductase)
ProGP568 (Cytochrome c biogenesis protein)
ProGP569 (Hypothetical protein)
ProGP577 (Nitric-oxide reductase large subunit)
ProGP576 (Penicillin amidase)
ProGP575 (Hypothetical protein)
ProGP574 (Peptide transporter)
ProGP573 (Hypothetical protein)
ProGP572 (Hypothetical protein)
ProGP571 (Hypothetical protein)
ProGP570 (Peptide transporter)
ProGP558 (ABC transporter substrate binding protei
ProGP343 (PilA (FTH_0384))
ProGP128 (wmA (S-layer protein))
ProGP116 (Endo-β-N-acetylglucosaminidase F3)
ProGP115 (Flavastacin (P40))
ProGP114 (Endo-β-N-acetylglucosaminidase F2)
ProGP113 (Flagellin Laf1)
ProGP112 (72-kDa glycoprotein (ExsJ))
ProGP111 (S-layer glycoprotein)
ProGP110 (45 to 47-kDa protein)
ProGP109 (Stable protease)
ProGP117 (Cell surface glycoprotein (S-layer protein))
ProGP118 (Flagellin)
ProGP119 (Fimbrial protein (pilin))
ProGP127 (Flagellin B1 (41 kDa))
ProGP126 (31/33 kDa flagellin)
ProGP125 (Flagellin)
ProGP124 (β-1,4-mannanase)
ProGP123 (CRX (Copper response extracellular protein))
ProGP122 (Surface layer glycoprotein SatA)
ProGP121 (Surface layer glycoprotein Sat B)
ProGP120 (Protein A (cell wall glycoprotein))
ProGP108 (Tetrabrachion (S layer glycoprotein))
ProGP107 (Fimbrial protein (pilin); (group I T4P))
ProGP95 (S-layer glycoprotein)
ProGP94 (Surface layer glycoprotein)
ProGP93 (Protein complex)
ProGP92 (Anitigen (1000 kDa protein))
ProGP91 (S-layer glycoprotein (82 kDa))
ProGP90 (Antigens)
ProGP89 (Surface layer glycoprotein)
ProGP88 (S-layer glycoprotein)
ProGP96 (PS2 (S-layer glycoprotein))
ProGP97 (27kDa flagellin)
ProGP98 (32kDa flagellin)
ProGP106 (Heparin lyase I or Heparinase I)
ProGP105 (S-layer glycoprotein)
ProGP104 (S-layer glycoprotein (138 kDa))
ProGP103 (Flagellin B2)
ProGP102 (Flagellin B1)
ProGP101 (H(A16-M) (1,3-1,4)-beta-glucanase)
ProGP100 (PF sheath protein (44 kDa))
ProGP99 (PilE (pilin))
ProGP87 (Cellulase (30 kDa) and Xylanase (15.7 kDa))
ProGP129 (RU 41740-P1 Glyoprotein fraction (non endotoxin))
ProGP171 (Man26A (b-mannosidase 26A))
ProGP159 (FlaB (flagellar core protein))
ProGP158 (FlaB (flagellar core protein))
ProGP157 (HBHA (heparin-binding hemagglutinin))
ProGP156 (AnAF)
ProGP155 (Flagellin)
ProGP154 (Flagellin)
ProGP153 (Flagellin)
ProGP152 (Type A Flagellin)
ProGP160 (Flagellar filament 31.3 kDa core protein
ProGP161 (FlaB (flagellar core protein))
ProGP162 (FlaB (flagellar core protein))
ProGP170 (Cysteine proteases (extracellular) Arg-gingipains (RgpA))
ProGP169 (Surface layer glycoproteins)
ProGP168 (Slp (S-layer glycoprotein))
ProGP167 (BclA (collagen-like protein))
ProGP166 (Chondroitinase-B)
ProGP165 (S-layer glycopeptide)
ProGP164 (FlaB (flagellar core protein))
ProGP163 (FlaB (flagellar core protein))
ProGP151 (P 110 (Adhesin-like glycoprotein 110 kDa))
ProGP150 (Cytochrome b558/566 subunit A (b type hemoprotein))
ProGP138 (Cell surface glycoprotein)
ProGP137 (Oscillin (65.8 kDa))
ProGP136 (Antigen (60 kDa))
ProGP135 (37-kDa protein)
ProGP134 (Exopolymer)
ProGP133 (Heparinase II)
ProGP132 (Chondroitinase-AC)
ProGP131 (Cell surface phosphatase)
ProGP139 (S-layer glycoprotein)
ProGP140 (α-Glucosidase (thermostable) 160 kDa)
ProGP141 (PGP)
ProGP149 (Crystal toxin (66 kDa))
ProGP148 (β-1,4-mannanase (G-enzyme))
ProGP147 (S-layer glycoprotein (29 kDa, forms tetramer))
ProGP146 (Flagellin)
ProGP145 (Adhesion inhibitor)
ProGP144 (S-layer glycoprotein (120 kDa))
ProGP143 (S-layer glycoprotein (101 kDa))
ProGP142 (Antifreeze protein)
ProGP130 (Pyrolysin)
ProGP86 (Cellulase complex (230 kDa subunit))
ProGP42 (Cellobiosidase)
ProGP30 (Flagellin B1)
ProGP29 (Flagellin A2)
ProGP28 (Flagellin A1)
ProGP27 (Cex (Exoglucanase or xylanase))
ProGP26 (CenA (Endoglucanase A))
ProGP25 (33 and 34 kDa antigens)
ProGP24 (Flagellin FlaB3)
ProGP23 (Flagellin FlaB2)
ProGP31 (Flagellin B2)
ProGP32 (Flagellin B3)
ProGP33 (Streptococcal acid glycoprotein SAGP)
ProGP41 (HPI (hexagonally packed intermediate) layer polypepetide)
ProGP40 (Long-fibril protein (LFP))
ProGP39 (Acidic glycoproteins (133-155 kDa))
ProGP38 (VGP (74 kDa))
ProGP37 (S-layer glycoprotein)
ProGP36 (S-layer glycoprotein)
ProGP35 (β-1,4-Endoglucanases)
ProGP34 (S-layer glycoprotein)
ProGP22 (Flagellin FlaB1)
ProGP21 (Outer membrane protein (75 kDa))
ProGP9 (8 kDa fimbrae)
ProGP8 (Membrane glycoprotein 152 kDa )
ProGP7 (Cellulase CB)
ProGP6 (Cellulase CA)
ProGP5 (Factor PG-1)
ProGP4 (F-pilin)
ProGP3 (S-layer glycoprotein)
ProGP2 (Phytotoxin)
ProGP10 (Flagellin)
ProGP11 (Autolysin (28 kDa))
ProGP12 (12 kDa antigen)
ProGP20 (Outer membrane protein (50 kDa))
ProGP19 (Outer membrane protein (26.5 kDa))
ProGP18 (S-layer glycoprotein SgsE)
ProGP17 (Flagellin)
ProGP16 (50 kDa antigen)
ProGP15 (N-acetylmuramoylhydrolase (Muramidase-2))
ProGP14 (Membrane glycoprotein)
ProGP13 (33 kDa antigen)
ProGP1 (Envelope specific glycoprotein)
ProGP43 (SlgA (cell surface glycoprotein))
ProGP85 (Auracyanin-B2 (18 kDa))
ProGP73 (p115/ PAAP)
ProGP72 (Alkaline Phosphatase D)
ProGP71 (S-layer glycoprotein)
ProGP70 ((1,3-1,4)-beta-glucanase (MAC))
ProGP69 (S-layer glycoprotein)
ProGP68 (S-layer glycoprotein)
ProGP67 (35 kDa flagellin)
ProGP66 (25 kDa flagellin)
ProGP74 (H(A107-M) (1,3-1,4)-beta-glucanase)
ProGP75 (S-layer glycoprotein)
ProGP76 (Cell surface lipoprotein MPB83 (25/23-kDa antigen))
ProGP84 (Auracyanin-B1 (22 kDa))
ProGP83 (Ice nucleation lipoglycoprotein)
ProGP82 (Ice nucleation lipoglycoprotein)
ProGP81 (S-layer glycoprotein)
ProGP80 (S-layer glycoprotein (115 kDa protein))
ProGP79 (S-layer glycoprotein)
ProGP78 (Cell surface glycoprotein (SlgA))
ProGP77 (Major outer membrane protein (MOMP, 40 kD))
ProGP65 (24 kDa flagellin)
ProGP64 (15 kDa-phosphate containing glycoprotein)
ProGP52 (Hypothetical protein)
ProGP51 (Alanine and proline-rich secreted protein Apa (50/55-kDa or 45 kDa MPT 32))
ProGP50 (Flagellin A)
ProGP49 (S-layer glycoprotein)
ProGP48 (S-layer glycoprotein)
ProGP47 (S-layer glycoprotein (92 kDa))
ProGP46 (S-layer glycoprotein (90 kDa))
ProGP45 (S-layer glycoprotein (94 kDa))
ProGP53 (33 kDa minor core flagellin)
ProGP54 (34 kDa major core flagellin)
ProGP55 (Cell surface protein/S-layer protein)
ProGP63 (Xylanase B (Endo-1,4-beta-xylanase B))
ProGP62 (18 kDa and 32 kDa lectin binding proteins
ProGP61 (S-layer glycoprotein (132 kDa))
ProGP60 (S-layer glycoprotein (118 kDa))
ProGP59 (β-1, 4-D-glucosidase (51 kDa))
ProGP58 (Thermopsin)
ProGP57 (38 kDa antigen)
ProGP56 (Cellulolosome complex (Cellulosomal-scaffolding protein A))
ProGP44 (S-layer glycoprotein)
ProGP299 (CcoP)
ProGP287 (PstS3)
ProGP286 (PstS2)
ProGP285 (PpiB)
ProGP284 (PonA2)
ProGP283 (OppA)
ProGP282 (prG)
ProGP281 (LprF)
ProGP280 (LpqW (lipoprotein))
ProGP288 (Rv0020c)
ProGP289 (Rv0281)
ProGP290 (Rv0907)
ProGP298 (FliC (Flagellin subunit))
ProGP297 (FlaB (Flagellin))
ProGP296 (FlaA (Flagellin))
ProGP295 (Thioredoxin)
ProGP294 (Secreted protease)
ProGP293 (Rv2813)
ProGP292 (Rv1084)
ProGP291 (Rv0988)
ProGP279 (LpqT (putative lipoprotein))
ProGP278 (LpqN)
ProGP266 (LprA)
ProGP265 (Rv2799)
ProGP264 (Glycosyl hydrolase)
ProGP263 (Rv3491)
ProGP262 (Pillin (Group IV))
ProGP261 (Flagellin (FlaA))
ProGP260 (FlaB2)
ProGP259 (FlaB1)
ProGP267 (GgtB)
ProGP268 (BfrB)
ProGP269 (Bglu)
ProGP277 (LpqI)
ProGP276 (LpqF lipoprotein)
ProGP275 (LpqB lipoprotein)
ProGP274 (LppZ (Putative lipoprotein))
ProGP273 (LppX (Putative lipoprotein))
ProGP272 (LppL)
ProGP271 (FecB)
ProGP270 (BlaC)
ProGP258 (FlaB3)
ProGP300 (CycB)
ProGP342 (FTH_0357)
ProGP330 (FTH_0159)
ProGP329 (FTH_1830)
ProGP328 (Extracellular matrix protein adhesin A (EmaA))
ProGP327 (LccA, an Archaeal Laccase)
ProGP326 (FliC (Flagellin))
ProGP325 (FliC (Flagellin))
ProGP324 (FliC (Flagellin))
ProGP323 (JlpA (42-45 kDa antigen))
ProGP331 (FTH_1855)
ProGP332 (FTH_0539)
ProGP333 (FTH_1112)
ProGP341 (FTH_0414)
ProGP340 (FTH_1071)
ProGP339 (FTH_0069)
ProGP338 (FTH_1293)
ProGP337 (FTH_1721)
ProGP336 (FTH_1761)
ProGP335 (FTH_1167)
ProGP334 (FTH_0311)
ProGP322 (EtpA Adhesin)
ProGP321 (OmpA)
ProGP309 (PstS (40 kDa))
ProGP308 (Sco)
ProGP307 (PotF)
ProGP306 (Mip (Peptidyl-prolyl cis-trans isomerase
ProGP305 (Laz)
ProGP304 (Gna1946)
ProGP303 (DsbA)
ProGP302 (AniA)
ProGP310 (Hypothetical protein)
ProGP311 (BF2494)
ProGP312 (Hypothetical protein)
ProGP320 (LppC)
ProGP319 (BF0935)
ProGP318 (BF3918)
ProGP317 (BF3567)
ProGP316 (Srr1)
ProGP315 (Putative outer membrane protein)
ProGP314 (Putative exported protein)
ProGP313 (Hypothetical protein)
ProGP301 (S-layer Protein)
ProGP257 (Microcystin-related protein C (MrpC))
ProGP213 (95-kDa glycoprotein)
ProGP201 (Diffuse Adherence Adhesin (AIDA-I))
ProGP200 (Laminin-binding glycoprotein (MS-LBP) or histone-like protein)
ProGP199 (Flagellin)
ProGP198 (Flagellin)
ProGP197 (Subtilisin (SBL)-Cys mutant)
ProGP196 (ComP)
ProGP195 (Streptococcal acid glycoprotein SAGP)
ProGP194 (PS4A (water soluble protein-polysaccharide))
ProGP202 (TMBP (Trehalose/maltose binding protein)
ProGP203 (Cell envelope glycoprotein)
ProGP204 (CbtA (Cellobiose binding protein)
ProGP212 (MDBP (Maltodextrin binding protein))
ProGP211 (TMBP (Trehalose/maltose binding protein)
ProGP210 (Protein-serine/threonine kinase (SsoPK1)
ProGP209 (Fap1 (Fimbrial adhesin))
ProGP208 (SbsD (S-layer glycoprotein))
ProGP207 (Glycopeptidolipid (GPL))
ProGP206 (Flagellin (FlaA))
ProGP205 (Flagellin A (FlaA))
ProGP193 (PstS1)
ProGP192 (LpqH)
ProGP180 (S-layer glycoprotein (27 kDa))
ProGP179 (S-layer glycoprotein)
ProGP178 (mtRgpA)
ProGP177 (HRgpA)
ProGP176 (TibA (outer membrane protein synthesized as preTibA))
ProGP175 (Flagellin B)
ProGP174 (Flagellin A)
ProGP173 (GBP (Glucose binding protein)/GlcS)
ProGP181 (P140 (140 kDa protein))
ProGP182 (P120 (120 kDa protein))
ProGP183 (GlnH)
ProGP191 (LppQ lipoprotein)
ProGP190 (LppN lipoprotein)
ProGP189 (Superoxide dismutase [Cu-Zn])
ProGP188 (flaB)
ProGP187 (flaA)
ProGP186 (98-kDa ,58-kDa, 54-kDa glycoproteins)
ProGP185 (Invertase)
ProGP184 (Mpt83 (Cell surface lipoprotein))
ProGP172 (S-layer glycoprotein)
ProGP214 (Flagellin B)
ProGP256 (CmeC)
ProGP244 (SrpA)
ProGP243 (Synthetic Glycopeptide)
ProGP242 (S-layer protein)
ProGP241 (FlaA)
ProGP240 (FlaB3)
ProGP239 (FlaB2)
ProGP238 (FlaB1)
ProGP237 (SgtA)
ProGP245 (SraP (serine-rich adhesin for platelets)
ProGP246 (BclB (collagen-like protein))
ProGP247 (Flagellin A)
ProGP255 (HmcA)
ProGP254 (Dps (18 kDa), Stress inducible DNA binding protein)
ProGP253 (DgpC)
ProGP252 (DgpA)
ProGP251 (Type b Flagellin)
ProGP250 (PilA (Pilin))
ProGP249 (Ag43α (Antigen 43 passenger domain))
ProGP248 (Flagellin B)
ProGP236 (HisJ)
ProGP235 (CipB (putative dipeptide-binding protein
ProGP223 (ZnuA)
ProGP222 (PEB3)
ProGP221 (Cj1496c)
ProGP220 (Cj0200c)
ProGP219 (Cj0114)
ProGP218 (CgpA)
ProGP217 (AcrA or CmeA)
ProGP216 (BclA (collagen-like protein))
ProGP224 (Flagellin)
ProGP225 (Flagellin)
ProGP226 (Flagellin)
ProGP234 (CipA (conserved hypothetical protein))
ProGP233 (Resuscitation promoting factor 2 (Rpf2))
ProGP232 (Flagellin FlaA)
ProGP231 (VirB10 protein)
ProGP230 (PilA (Type IV pilin))
ProGP229 (GspB)
ProGP228 (Short glycopeptides)
ProGP227 (HMW1 (Adhesin))
ProGP215 (Flagellin A (FlaA))
Compare ID
Choose Compare Id
ProGP471 (Putative uncharacterized protein)
ProGP459 (ABC-type amino acid transport system secreted component)
ProGP458 (ThuA)
ProGP457 (LppO (Putative lipoprotein))
ProGP456 (Rv3835)
ProGP455 (35kDa protein)
ProGP454 (Rv1887)
ProGP453 (Probable conserved MCE associated membrane protein)
ProGP452 (Probable conserved proline rich membrane protein (MT2222))
ProGP460 (Putative protein)
ProGP461 (Putative uncharacterized protein)
ProGP462 (Putative uncharacterized protein)
ProGP470 (Putative uncharacterized protein)
ProGP469 (MdtA multidrug resistance protein)
ProGP468 (C-terminal protease)
ProGP467 (Alanine and proline-rich secreted protei
ProGP466 (Putative protein)
ProGP465 (Immunogenic protein MPT63)
ProGP464 (Putative protein)
ProGP463 (Immunogenic protein MPT63)
ProGP451 (COK_1394)
ProGP450 (AtaC)
ProGP438 (DnaK)
ProGP437 (FliC (Type B Flagellin))
ProGP436 (Acm2)
ProGP435 (FasC (fasciclin domain protein))
ProGP434 (Arabinose ABC transporter, arabinose binding protein (AraS))
ProGP433 (Hypothetical protein)
ProGP432 (Hypothetical protein)
ProGP431 (Hypothetical protein)
ProGP439 (Lp_2260)
ProGP440 (Lp_2162)
ProGP441 (Lp_1643)
ProGP449 (PsrP (Adhesin))
ProGP448 (MOMP)
ProGP447 (FtsZ)
ProGP446 (Lp_3421)
ProGP445 (FtsK1)
ProGP444 (Lp_ 2793)
ProGP443 (FtsY)
ProGP442 (PdhC)
ProGP430 (Serine protease)
ProGP472 (Putative signal peptide)
ProGP514 (EmaA)
ProGP502 (Uncharacterized protein)
ProGP501 (Uncharacterized protein)
ProGP500 (Uncharacterized protein)
ProGP499 (Uncharacterized protein)
ProGP498 (Uncharacterized protein)
ProGP497 (Putative secretion protein)
ProGP496 (PliA)
ProGP495 (EF-P)
ProGP503 (Uncharacterized protein)
ProGP504 (Uncharacterized protein)
ProGP505 (Laz (lipid-modified azurin))
ProGP513 (Knh)
ProGP512 (Enterocin F4-9)
ProGP511 (Translation elongation factor P (EF-P))
ProGP510 (Translation elongation factor P (EF-P))
ProGP509 (Ccop)
ProGP508 (Mip (Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA))
ProGP507 (Sco)
ProGP506 (MetQ)
ProGP494 (FliC (Flagellin))
ProGP493 (CN)
ProGP481 (CpxP-like protein)
ProGP480 (Putative fusaric acid resistance transporter protein)
ProGP479 (Putative lipoprotein)
ProGP478 (Putative uncharacterized protein)
ProGP477 (Putative cell division related protein)
ProGP476 (Putative MCE (mammalian cell entry) related protein)
ProGP475 (Putative uncharacterized protein)
ProGP474 (Putative phospholipid-binding lipoprotei
ProGP482 (ComEA)
ProGP483 (Putative PRC barrel containing lipoprote
ProGP484 (Putative exported protein)
ProGP492 (Type IV Pilin)
ProGP491 (Putative uncharacterized protein)
ProGP490 (OmpA family protein)
ProGP489 (Cell division protein)
ProGP488 (OmlA)
ProGP487 (OM lipoprotein carrier LolA)
ProGP486 (Putative membrane protein)
ProGP485 (oprM efflux system outer membrane protein)
ProGP473 (Peptidoglycan-binding membrane protein)
ProGP429 (Maltose ABC transporter)
ProGP385 (Cj0983 (Putative lipoprotein))
ProGP373 (Putative periplasmic protein)
ProGP372 (Putative periplasmic protein)
ProGP371 (Putative secreted protease)
ProGP370 (Putative exporting protein)
ProGP369 (Putative membrane protein)
ProGP368 (Colicin V production protein)
ProGP367 (Putative uncharacterized protein)
ProGP366 (UPF0323 lipoprotein Cj0371)
ProGP374 (Putative integral membrane protein)
ProGP375 (Putative OmpA family membrane protein)
ProGP376 (Putative outer membrane efflux protein)
ProGP384 (Cj0982c (Putative amino acid transporter periplasmic solute-binding protein CjaA))
ProGP383 (Uncharacterized metallophosphoesterase)
ProGP382 (Putative secreted transglycosylase)
ProGP381 (Cj0783 (Periplasmic nitrate reductase small subunit))
ProGP380 (Putative periplasmic protein)
ProGP379 (Cj0652 (Penicillin-binding protein))
ProGP378 (Putative membrane protein)
ProGP377 (Putative periplasmic protein)
ProGP365 (Cj0366c (Inner membrane multidrug efflux system protein CmeB))
ProGP364 (Putative integral membrane protein)
ProGP352 (Putative cell division protein)
ProGP351 (BF0810)
ProGP350 (TF2339)
ProGP349 (TF1259)
ProGP348 (TfsB (S-layer protein))
ProGP347 (Spermidine/putrescine-binding protein (PotD))
ProGP346 (Chondroitinase ABC)
ProGP345 (Mfa1 (67 kDa minor fimbrillin))
ProGP353 (Putative exported protein)
ProGP354 (Putative non-specific DNA-binding protein)
ProGP355 (Cj0017c (Disulfide bond formation protein))
ProGP363 (Cj0277 (Rod shape-determining protein))
ProGP362 (Putative sulfatase family protein)
ProGP361 (Putative mechanosensitive ion channel family protein)
ProGP360 (Cj0235c (Putative protein export protein))
ProGP359 (Putative membrane protein)
ProGP358 (Putative membrane protein)
ProGP357 (Putative lipoprotein)
ProGP356 (Cj0081 (Cytochrome bd oxidase subunit I))
ProGP344 (SlaA (S-layer protein))
ProGP386 (Putative mechanosensitive ion channel family protein)
ProGP428 (Protease)
ProGP416 (Putative Uncharacterized Protein)
ProGP415 (Putative Uncharacterized Protein)
ProGP414 (Putative Uncharacterized Protein)
ProGP413 (Putative Uncharacterized Protein)
ProGP412 (OmpA/MotB)
ProGP411 (FTL_1096)
ProGP410 (DsbA)
ProGP409 (FliC (Flagellin))
ProGP417 (Putative Uncharacterized Protein)
ProGP418 (Putative Uncharacterized Protein)
ProGP419 (PilA)
ProGP427 (Hypothetical protein)
ProGP426 (Oligopeptide binding protein)
ProGP425 (ABC Transporter (TreS))
ProGP424 (Dipeptide ABC transporter, periplasmic dipeptide binding protein (dppA))
ProGP423 (AniA)
ProGP422 (LafA (Lateral flagellin))
ProGP421 (FlaB (Polar flagellin))
ProGP420 (FlaA (Polar flagellin))
ProGP408 (FliC (Flagellin))
ProGP407 (EhaJ (autotranporter))
ProGP395 (Cj1565c (Paralyzed flagellum protein))
ProGP394 (Cj1444c (Capsule polysaccharide export system periplasmic protein))
ProGP393 (Putative integral membrane protein)
ProGP392 (Putative periplasmic protein)
ProGP391 (Cj1126c (Oligosaccharyltransferase))
ProGP390 (Putative sulfatase protein)
ProGP389 (Putative integral membrane protein)
ProGP388 (Cj1032 (Membrane fusion component multidrug efflux system))
ProGP396 (Putative periplasmic protein)
ProGP397 (Possible ABC transport system permease)
ProGP398 (Lectin LecB)
ProGP406 (TF1056)
ProGP405 (TF0091)
ProGP404 (FlaB (Flagellin))
ProGP403 (FlaA (Flagellin))
ProGP402 (Glycocin F)
ProGP401 (Plantaricin ASM1)
ProGP400 (Sublancin)
ProGP399 (TfsA (S-layer protein))
ProGP387 (Putative cytochrome c biogenesis protein)
ProGP642 (Cytochrome c assembly protein)
ProGP630 (Hypothetical protein)
ProGP629 (ATPase)
ProGP628 (ABC transporter substrate binding protein)
ProGP627 (Hypothetical protein)
ProGP626 (Serpin)
ProGP625 (Hypothetical protein)
ProGP624 (Branched chain amino acid ABC transporter substrate binding protein)
ProGP623 (Hypothetical protein)
ProGP631 (ABC transporter)
ProGP632 (ABC transporter substrate binding protein)
ProGP633 (Hypothetical protein)
ProGP641 (Hypothetical protein)
ProGP640 (Primosomal protein)
ProGP639 (ABC transporter periplasmic binding protein)
ProGP638 (Excisionase)
ProGP637 (Cytochrome c biogenesis protein)
ProGP636 (NosD)
ProGP635 (TRAP ABC transporter)
ProGP634 (Peptide ABC transporter permease)
ProGP622 (NADH-ubiquinone oxidoreductase)
ProGP621 (Sugar binding protein)
ProGP609 (Hypothetical protein)
ProGP608 (Sugar ABC transporter substrate binding protein)
ProGP607 (Geranylgeranyl reductase)
ProGP606 (ABC transporter substrate binding protein)
ProGP605 (Hypothetical protein branched chain amino acid ABC transporter substrate binding protein
ProGP604 (Iron ABC transporter substrate binding protein)
ProGP603 (ABC transporter substrate binding protein)
ProGP602 (FAD-dependent oxidoreductase)
ProGP610 (Hypothetical protein)
ProGP611 (Phosphate starvation protein PhoH)
ProGP612 (ABC transporter)
ProGP620 (Hypothetical protein)
ProGP619 (Hypothetical protein)
ProGP618 (Hypothetical protein)
ProGP617 (Nodulation efficiency protein NfeD)
ProGP616 (NADH dehydrogenase subunit D)
ProGP615 (Hypothetical protein)
ProGP614 (Glutamate dehydrogenase)
ProGP613 (Nitrous oxidase accessory protein)
ProGP601 (Transglutaminase)
ProGP643 (Glycosyltransferase)
ProGP685 (Cnm)
ProGP673 (FHA domain containing protein)
ProGP672 (Hypothetical protein)
ProGP671 (Hypothetical protein)
ProGP670 (Hypothetical protein)
ProGP669 (ABC transporter)
ProGP668 (Hypothetical protein)
ProGP667 (V-type ATP synthase subunit E)
ProGP666 (ABC transporter)
ProGP674 (Hypothetical protein)
ProGP675 (Hypothetical protein)
ProGP676 (Hypothetical protein)
ProGP684 (WpaA)
ProGP683 (Flagellin)
ProGP682 (Flagellin)
ProGP681 (Formate dehydrogenase)
ProGP680 (Peptidase S8)
ProGP679 (Nitrate reductase alpha subunit)
ProGP678 (Hypothetical protein)
ProGP677 (Hypothetical protein)
ProGP665 (ABC transporter)
ProGP664 (V-type ATPase subunit D)
ProGP652 (Amino acid ABC transporter substrate binding protein)
ProGP651 (4Fe-4S ferredoxin)
ProGP650 (Hypothetical protein)
ProGP649 (Transcriptional regulator)
ProGP648 (Nitrate reductase)
ProGP647 (Hypothetical protein)
ProGP646 (Glycosyltransferase)
ProGP645 (ABC transporter substrate binding protein)
ProGP653 (Hypothetical protein)
ProGP654 (SCO1/SenC)
ProGP655 (Hypothetical protein)
ProGP663 (Protein disulfide isomerase like protein)
ProGP662 (30S ribosomal protein S2)
ProGP661 (Eight cysteine cluster domain containing protein)
ProGP660 (Hypothetical protein)
ProGP659 (Hypothetical protein)
ProGP658 (Hypothetical protein)
ProGP657 (Transcriptional regulator)
ProGP656 (RNA methyltransferase)
ProGP644 (Hypothetical protein)
ProGP600 (Hypothetical protein)
ProGP556 (Arabinase)
ProGP544 (Flagellin A2)
ProGP543 (Flagellin A1)
ProGP542 (Translation elongation factor P (EF-P))
ProGP541 (FtsL)
ProGP540 (Probable peptidase transmembrane protein)
ProGP539 (PilA)
ProGP538 (Probable transmembrane protein)
ProGP537 (Peptidyl-prolyl cis-trans isomerase)
ProGP545 (Pilin A1)
ProGP546 (Pilin A2)
ProGP547 (Pilin A3)
ProGP555 (Hypothetical protein)
ProGP554 (Hypothetical protein)
ProGP553 (Hypothetical protein)
ProGP552 (Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96)
ProGP551 (Pls (Plasmin sensitive surface protein))
ProGP550 (Pls (Plasmin sensitive surface protein))
ProGP549 (Pilin A6)
ProGP548 (Pilin A4)
ProGP536 (Probable transmembrane protein)
ProGP535 (Probable lipoprotein)
ProGP523 (Probable lipoprotein transmembrane)
ProGP522 (Putative membrane fusion protein)
ProGP521 (EF-P)
ProGP520 (Hag flagellin)
ProGP519 (Slg2 (S-layer glycoprotein))
ProGP518 (Slg1 (S-layer glycoprotein))
ProGP517 (CcoP)
ProGP516 (C5)
ProGP524 (Probable transmembrane protein)
ProGP525 (Hypothetical signal peptide protein)
ProGP526 (RagB)
ProGP534 (PilN)
ProGP533 (Probable m20-related peptidase)
ProGP532 (Probable serine protease protein)
ProGP531 (Probable transmembrane protein)
ProGP530 (D-(−)-3-hydroxybutyrate oligomer hydrolase)
ProGP529 (AcrA)
ProGP528 (FtsN)
ProGP527 (Probable tpr domain signal peptide protein)
ProGP515 (NirK)
ProGP557 (Hypothetical protein)
ProGP599 (Hypothetical protein)
ProGP587 (Chloride channel protein)
ProGP586 (Hypothetical protein)
ProGP585 (Hypothetical protein)
ProGP584 (Hypothetical protein)
ProGP583 (ATP synthase subunit A)
ProGP582 (Metallophosphoesterase)
ProGP581 (Cytochrome c assembly)
ProGP580 (Histidine kinase)
ProGP588 (Hypothetical protein)
ProGP589 (Thermosome subunit)
ProGP590 (Hypothetical protein)
ProGP598 (Peptidase M50)
ProGP597 (Hypothetical protein)
ProGP596 (Nitrate reductase beta subunit)
ProGP595 (Glycosyl transferase)
ProGP594 (ABC transporter substrate binding protei
ProGP593 (Hypothetical protein)
ProGP592 (Peptidase)
ProGP591 (Peptide ABC transporter substrate bindin protein)
ProGP579 (Hypothetical protein)
ProGP578 (Cytochrome c biogenesis protein)
ProGP566 (Multidrug RND transporter)
ProGP565 (Peptide binding protein)
ProGP564 (Hypothetical protein)
ProGP563 (Pullulanase)
ProGP562 (Hypothetical protein)
ProGP561 (Hypothetical protein)
ProGP560 (Hypothetical protein)
ProGP559 (Pullulanase)
ProGP567 (Molybdopterin oxidoreductase)
ProGP568 (Cytochrome c biogenesis protein)
ProGP569 (Hypothetical protein)
ProGP577 (Nitric-oxide reductase large subunit)
ProGP576 (Penicillin amidase)
ProGP575 (Hypothetical protein)
ProGP574 (Peptide transporter)
ProGP573 (Hypothetical protein)
ProGP572 (Hypothetical protein)
ProGP571 (Hypothetical protein)
ProGP570 (Peptide transporter)
ProGP558 (ABC transporter substrate binding protei
ProGP343 (PilA (FTH_0384))
ProGP128 (wmA (S-layer protein))
ProGP116 (Endo-β-N-acetylglucosaminidase F3)
ProGP115 (Flavastacin (P40))
ProGP114 (Endo-β-N-acetylglucosaminidase F2)
ProGP113 (Flagellin Laf1)
ProGP112 (72-kDa glycoprotein (ExsJ))
ProGP111 (S-layer glycoprotein)
ProGP110 (45 to 47-kDa protein)
ProGP109 (Stable protease)
ProGP117 (Cell surface glycoprotein (S-layer protein))
ProGP118 (Flagellin)
ProGP119 (Fimbrial protein (pilin))
ProGP127 (Flagellin B1 (41 kDa))
ProGP126 (31/33 kDa flagellin)
ProGP125 (Flagellin)
ProGP124 (β-1,4-mannanase)
ProGP123 (CRX (Copper response extracellular protein))
ProGP122 (Surface layer glycoprotein SatA)
ProGP121 (Surface layer glycoprotein Sat B)
ProGP120 (Protein A (cell wall glycoprotein))
ProGP108 (Tetrabrachion (S layer glycoprotein))
ProGP107 (Fimbrial protein (pilin); (group I T4P))
ProGP95 (S-layer glycoprotein)
ProGP94 (Surface layer glycoprotein)
ProGP93 (Protein complex)
ProGP92 (Anitigen (1000 kDa protein))
ProGP91 (S-layer glycoprotein (82 kDa))
ProGP90 (Antigens)
ProGP89 (Surface layer glycoprotein)
ProGP88 (S-layer glycoprotein)
ProGP96 (PS2 (S-layer glycoprotein))
ProGP97 (27kDa flagellin)
ProGP98 (32kDa flagellin)
ProGP106 (Heparin lyase I or Heparinase I)
ProGP105 (S-layer glycoprotein)
ProGP104 (S-layer glycoprotein (138 kDa))
ProGP103 (Flagellin B2)
ProGP102 (Flagellin B1)
ProGP101 (H(A16-M) (1,3-1,4)-beta-glucanase)
ProGP100 (PF sheath protein (44 kDa))
ProGP99 (PilE (pilin))
ProGP87 (Cellulase (30 kDa) and Xylanase (15.7 kDa))
ProGP129 (RU 41740-P1 Glyoprotein fraction (non endotoxin))
ProGP171 (Man26A (b-mannosidase 26A))
ProGP159 (FlaB (flagellar core protein))
ProGP158 (FlaB (flagellar core protein))
ProGP157 (HBHA (heparin-binding hemagglutinin))
ProGP156 (AnAF)
ProGP155 (Flagellin)
ProGP154 (Flagellin)
ProGP153 (Flagellin)
ProGP152 (Type A Flagellin)
ProGP160 (Flagellar filament 31.3 kDa core protein
ProGP161 (FlaB (flagellar core protein))
ProGP162 (FlaB (flagellar core protein))
ProGP170 (Cysteine proteases (extracellular) Arg-gingipains (RgpA))
ProGP169 (Surface layer glycoproteins)
ProGP168 (Slp (S-layer glycoprotein))
ProGP167 (BclA (collagen-like protein))
ProGP166 (Chondroitinase-B)
ProGP165 (S-layer glycopeptide)
ProGP164 (FlaB (flagellar core protein))
ProGP163 (FlaB (flagellar core protein))
ProGP151 (P 110 (Adhesin-like glycoprotein 110 kDa))
ProGP150 (Cytochrome b558/566 subunit A (b type hemoprotein))
ProGP138 (Cell surface glycoprotein)
ProGP137 (Oscillin (65.8 kDa))
ProGP136 (Antigen (60 kDa))
ProGP135 (37-kDa protein)
ProGP134 (Exopolymer)
ProGP133 (Heparinase II)
ProGP132 (Chondroitinase-AC)
ProGP131 (Cell surface phosphatase)
ProGP139 (S-layer glycoprotein)
ProGP140 (α-Glucosidase (thermostable) 160 kDa)
ProGP141 (PGP)
ProGP149 (Crystal toxin (66 kDa))
ProGP148 (β-1,4-mannanase (G-enzyme))
ProGP147 (S-layer glycoprotein (29 kDa, forms tetramer))
ProGP146 (Flagellin)
ProGP145 (Adhesion inhibitor)
ProGP144 (S-layer glycoprotein (120 kDa))
ProGP143 (S-layer glycoprotein (101 kDa))
ProGP142 (Antifreeze protein)
ProGP130 (Pyrolysin)
ProGP86 (Cellulase complex (230 kDa subunit))
ProGP42 (Cellobiosidase)
ProGP30 (Flagellin B1)
ProGP29 (Flagellin A2)
ProGP28 (Flagellin A1)
ProGP27 (Cex (Exoglucanase or xylanase))
ProGP26 (CenA (Endoglucanase A))
ProGP25 (33 and 34 kDa antigens)
ProGP24 (Flagellin FlaB3)
ProGP23 (Flagellin FlaB2)
ProGP31 (Flagellin B2)
ProGP32 (Flagellin B3)
ProGP33 (Streptococcal acid glycoprotein SAGP)
ProGP41 (HPI (hexagonally packed intermediate) layer polypepetide)
ProGP40 (Long-fibril protein (LFP))
ProGP39 (Acidic glycoproteins (133-155 kDa))
ProGP38 (VGP (74 kDa))
ProGP37 (S-layer glycoprotein)
ProGP36 (S-layer glycoprotein)
ProGP35 (β-1,4-Endoglucanases)
ProGP34 (S-layer glycoprotein)
ProGP22 (Flagellin FlaB1)
ProGP21 (Outer membrane protein (75 kDa))
ProGP9 (8 kDa fimbrae)
ProGP8 (Membrane glycoprotein 152 kDa )
ProGP7 (Cellulase CB)
ProGP6 (Cellulase CA)
ProGP5 (Factor PG-1)
ProGP4 (F-pilin)
ProGP3 (S-layer glycoprotein)
ProGP2 (Phytotoxin)
ProGP10 (Flagellin)
ProGP11 (Autolysin (28 kDa))
ProGP12 (12 kDa antigen)
ProGP20 (Outer membrane protein (50 kDa))
ProGP19 (Outer membrane protein (26.5 kDa))
ProGP18 (S-layer glycoprotein SgsE)
ProGP17 (Flagellin)
ProGP16 (50 kDa antigen)
ProGP15 (N-acetylmuramoylhydrolase (Muramidase-2))
ProGP14 (Membrane glycoprotein)
ProGP13 (33 kDa antigen)
ProGP1 (Envelope specific glycoprotein)
ProGP43 (SlgA (cell surface glycoprotein))
ProGP85 (Auracyanin-B2 (18 kDa))
ProGP73 (p115/ PAAP)
ProGP72 (Alkaline Phosphatase D)
ProGP71 (S-layer glycoprotein)
ProGP70 ((1,3-1,4)-beta-glucanase (MAC))
ProGP69 (S-layer glycoprotein)
ProGP68 (S-layer glycoprotein)
ProGP67 (35 kDa flagellin)
ProGP66 (25 kDa flagellin)
ProGP74 (H(A107-M) (1,3-1,4)-beta-glucanase)
ProGP75 (S-layer glycoprotein)
ProGP76 (Cell surface lipoprotein MPB83 (25/23-kDa antigen))
ProGP84 (Auracyanin-B1 (22 kDa))
ProGP83 (Ice nucleation lipoglycoprotein)
ProGP82 (Ice nucleation lipoglycoprotein)
ProGP81 (S-layer glycoprotein)
ProGP80 (S-layer glycoprotein (115 kDa protein))
ProGP79 (S-layer glycoprotein)
ProGP78 (Cell surface glycoprotein (SlgA))
ProGP77 (Major outer membrane protein (MOMP, 40 kD))
ProGP65 (24 kDa flagellin)
ProGP64 (15 kDa-phosphate containing glycoprotein)
ProGP52 (Hypothetical protein)
ProGP51 (Alanine and proline-rich secreted protein Apa (50/55-kDa or 45 kDa MPT 32))
ProGP50 (Flagellin A)
ProGP49 (S-layer glycoprotein)
ProGP48 (S-layer glycoprotein)
ProGP47 (S-layer glycoprotein (92 kDa))
ProGP46 (S-layer glycoprotein (90 kDa))
ProGP45 (S-layer glycoprotein (94 kDa))
ProGP53 (33 kDa minor core flagellin)
ProGP54 (34 kDa major core flagellin)
ProGP55 (Cell surface protein/S-layer protein)
ProGP63 (Xylanase B (Endo-1,4-beta-xylanase B))
ProGP62 (18 kDa and 32 kDa lectin binding proteins
ProGP61 (S-layer glycoprotein (132 kDa))
ProGP60 (S-layer glycoprotein (118 kDa))
ProGP59 (β-1, 4-D-glucosidase (51 kDa))
ProGP58 (Thermopsin)
ProGP57 (38 kDa antigen)
ProGP56 (Cellulolosome complex (Cellulosomal-scaffolding protein A))
ProGP44 (S-layer glycoprotein)
ProGP299 (CcoP)
ProGP287 (PstS3)
ProGP286 (PstS2)
ProGP285 (PpiB)
ProGP284 (PonA2)
ProGP283 (OppA)
ProGP282 (prG)
ProGP281 (LprF)
ProGP280 (LpqW (lipoprotein))
ProGP288 (Rv0020c)
ProGP289 (Rv0281)
ProGP290 (Rv0907)
ProGP298 (FliC (Flagellin subunit))
ProGP297 (FlaB (Flagellin))
ProGP296 (FlaA (Flagellin))
ProGP295 (Thioredoxin)
ProGP294 (Secreted protease)
ProGP293 (Rv2813)
ProGP292 (Rv1084)
ProGP291 (Rv0988)
ProGP279 (LpqT (putative lipoprotein))
ProGP278 (LpqN)
ProGP266 (LprA)
ProGP265 (Rv2799)
ProGP264 (Glycosyl hydrolase)
ProGP263 (Rv3491)
ProGP262 (Pillin (Group IV))
ProGP261 (Flagellin (FlaA))
ProGP260 (FlaB2)
ProGP259 (FlaB1)
ProGP267 (GgtB)
ProGP268 (BfrB)
ProGP269 (Bglu)
ProGP277 (LpqI)
ProGP276 (LpqF lipoprotein)
ProGP275 (LpqB lipoprotein)
ProGP274 (LppZ (Putative lipoprotein))
ProGP273 (LppX (Putative lipoprotein))
ProGP272 (LppL)
ProGP271 (FecB)
ProGP270 (BlaC)
ProGP258 (FlaB3)
ProGP300 (CycB)
ProGP342 (FTH_0357)
ProGP330 (FTH_0159)
ProGP329 (FTH_1830)
ProGP328 (Extracellular matrix protein adhesin A (EmaA))
ProGP327 (LccA, an Archaeal Laccase)
ProGP326 (FliC (Flagellin))
ProGP325 (FliC (Flagellin))
ProGP324 (FliC (Flagellin))
ProGP323 (JlpA (42-45 kDa antigen))
ProGP331 (FTH_1855)
ProGP332 (FTH_0539)
ProGP333 (FTH_1112)
ProGP341 (FTH_0414)
ProGP340 (FTH_1071)
ProGP339 (FTH_0069)
ProGP338 (FTH_1293)
ProGP337 (FTH_1721)
ProGP336 (FTH_1761)
ProGP335 (FTH_1167)
ProGP334 (FTH_0311)
ProGP322 (EtpA Adhesin)
ProGP321 (OmpA)
ProGP309 (PstS (40 kDa))
ProGP308 (Sco)
ProGP307 (PotF)
ProGP306 (Mip (Peptidyl-prolyl cis-trans isomerase
ProGP305 (Laz)
ProGP304 (Gna1946)
ProGP303 (DsbA)
ProGP302 (AniA)
ProGP310 (Hypothetical protein)
ProGP311 (BF2494)
ProGP312 (Hypothetical protein)
ProGP320 (LppC)
ProGP319 (BF0935)
ProGP318 (BF3918)
ProGP317 (BF3567)
ProGP316 (Srr1)
ProGP315 (Putative outer membrane protein)
ProGP314 (Putative exported protein)
ProGP313 (Hypothetical protein)
ProGP301 (S-layer Protein)
ProGP257 (Microcystin-related protein C (MrpC))
ProGP213 (95-kDa glycoprotein)
ProGP201 (Diffuse Adherence Adhesin (AIDA-I))
ProGP200 (Laminin-binding glycoprotein (MS-LBP) or histone-like protein)
ProGP199 (Flagellin)
ProGP198 (Flagellin)
ProGP197 (Subtilisin (SBL)-Cys mutant)
ProGP196 (ComP)
ProGP195 (Streptococcal acid glycoprotein SAGP)
ProGP194 (PS4A (water soluble protein-polysaccharide))
ProGP202 (TMBP (Trehalose/maltose binding protein)
ProGP203 (Cell envelope glycoprotein)
ProGP204 (CbtA (Cellobiose binding protein)
ProGP212 (MDBP (Maltodextrin binding protein))
ProGP211 (TMBP (Trehalose/maltose binding protein)
ProGP210 (Protein-serine/threonine kinase (SsoPK1)
ProGP209 (Fap1 (Fimbrial adhesin))
ProGP208 (SbsD (S-layer glycoprotein))
ProGP207 (Glycopeptidolipid (GPL))
ProGP206 (Flagellin (FlaA))
ProGP205 (Flagellin A (FlaA))
ProGP193 (PstS1)
ProGP192 (LpqH)
ProGP180 (S-layer glycoprotein (27 kDa))
ProGP179 (S-layer glycoprotein)
ProGP178 (mtRgpA)
ProGP177 (HRgpA)
ProGP176 (TibA (outer membrane protein synthesized as preTibA))
ProGP175 (Flagellin B)
ProGP174 (Flagellin A)
ProGP173 (GBP (Glucose binding protein)/GlcS)
ProGP181 (P140 (140 kDa protein))
ProGP182 (P120 (120 kDa protein))
ProGP183 (GlnH)
ProGP191 (LppQ lipoprotein)
ProGP190 (LppN lipoprotein)
ProGP189 (Superoxide dismutase [Cu-Zn])
ProGP188 (flaB)
ProGP187 (flaA)
ProGP186 (98-kDa ,58-kDa, 54-kDa glycoproteins)
ProGP185 (Invertase)
ProGP184 (Mpt83 (Cell surface lipoprotein))
ProGP172 (S-layer glycoprotein)
ProGP214 (Flagellin B)
ProGP256 (CmeC)
ProGP244 (SrpA)
ProGP243 (Synthetic Glycopeptide)
ProGP242 (S-layer protein)
ProGP241 (FlaA)
ProGP240 (FlaB3)
ProGP239 (FlaB2)
ProGP238 (FlaB1)
ProGP237 (SgtA)
ProGP245 (SraP (serine-rich adhesin for platelets)
ProGP246 (BclB (collagen-like protein))
ProGP247 (Flagellin A)
ProGP255 (HmcA)
ProGP254 (Dps (18 kDa), Stress inducible DNA binding protein)
ProGP253 (DgpC)
ProGP252 (DgpA)
ProGP251 (Type b Flagellin)
ProGP250 (PilA (Pilin))
ProGP249 (Ag43α (Antigen 43 passenger domain))
ProGP248 (Flagellin B)
ProGP236 (HisJ)
ProGP235 (CipB (putative dipeptide-binding protein
ProGP223 (ZnuA)
ProGP222 (PEB3)
ProGP221 (Cj1496c)
ProGP220 (Cj0200c)
ProGP219 (Cj0114)
ProGP218 (CgpA)
ProGP217 (AcrA or CmeA)
ProGP216 (BclA (collagen-like protein))
ProGP224 (Flagellin)
ProGP225 (Flagellin)
ProGP226 (Flagellin)
ProGP234 (CipA (conserved hypothetical protein))
ProGP233 (Resuscitation promoting factor 2 (Rpf2))
ProGP232 (Flagellin FlaA)
ProGP231 (VirB10 protein)
ProGP230 (PilA (Type IV pilin))
ProGP229 (GspB)
ProGP228 (Short glycopeptides)
ProGP227 (HMW1 (Adhesin))
ProGP215 (Flagellin A (FlaA))
Compare ID
Choose Compare Id
ProGP471 (Putative uncharacterized protein)
ProGP459 (ABC-type amino acid transport system secreted component)
ProGP458 (ThuA)
ProGP457 (LppO (Putative lipoprotein))
ProGP456 (Rv3835)
ProGP455 (35kDa protein)
ProGP454 (Rv1887)
ProGP453 (Probable conserved MCE associated membrane protein)
ProGP452 (Probable conserved proline rich membrane protein (MT2222))
ProGP460 (Putative protein)
ProGP461 (Putative uncharacterized protein)
ProGP462 (Putative uncharacterized protein)
ProGP470 (Putative uncharacterized protein)
ProGP469 (MdtA multidrug resistance protein)
ProGP468 (C-terminal protease)
ProGP467 (Alanine and proline-rich secreted protei
ProGP466 (Putative protein)
ProGP465 (Immunogenic protein MPT63)
ProGP464 (Putative protein)
ProGP463 (Immunogenic protein MPT63)
ProGP451 (COK_1394)
ProGP450 (AtaC)
ProGP438 (DnaK)
ProGP437 (FliC (Type B Flagellin))
ProGP436 (Acm2)
ProGP435 (FasC (fasciclin domain protein))
ProGP434 (Arabinose ABC transporter, arabinose binding protein (AraS))
ProGP433 (Hypothetical protein)
ProGP432 (Hypothetical protein)
ProGP431 (Hypothetical protein)
ProGP439 (Lp_2260)
ProGP440 (Lp_2162)
ProGP441 (Lp_1643)
ProGP449 (PsrP (Adhesin))
ProGP448 (MOMP)
ProGP447 (FtsZ)
ProGP446 (Lp_3421)
ProGP445 (FtsK1)
ProGP444 (Lp_ 2793)
ProGP443 (FtsY)
ProGP442 (PdhC)
ProGP430 (Serine protease)
ProGP472 (Putative signal peptide)
ProGP514 (EmaA)
ProGP502 (Uncharacterized protein)
ProGP501 (Uncharacterized protein)
ProGP500 (Uncharacterized protein)
ProGP499 (Uncharacterized protein)
ProGP498 (Uncharacterized protein)
ProGP497 (Putative secretion protein)
ProGP496 (PliA)
ProGP495 (EF-P)
ProGP503 (Uncharacterized protein)
ProGP504 (Uncharacterized protein)
ProGP505 (Laz (lipid-modified azurin))
ProGP513 (Knh)
ProGP512 (Enterocin F4-9)
ProGP511 (Translation elongation factor P (EF-P))
ProGP510 (Translation elongation factor P (EF-P))
ProGP509 (Ccop)
ProGP508 (Mip (Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA))
ProGP507 (Sco)
ProGP506 (MetQ)
ProGP494 (FliC (Flagellin))
ProGP493 (CN)
ProGP481 (CpxP-like protein)
ProGP480 (Putative fusaric acid resistance transporter protein)
ProGP479 (Putative lipoprotein)
ProGP478 (Putative uncharacterized protein)
ProGP477 (Putative cell division related protein)
ProGP476 (Putative MCE (mammalian cell entry) related protein)
ProGP475 (Putative uncharacterized protein)
ProGP474 (Putative phospholipid-binding lipoprotei
ProGP482 (ComEA)
ProGP483 (Putative PRC barrel containing lipoprote
ProGP484 (Putative exported protein)
ProGP492 (Type IV Pilin)
ProGP491 (Putative uncharacterized protein)
ProGP490 (OmpA family protein)
ProGP489 (Cell division protein)
ProGP488 (OmlA)
ProGP487 (OM lipoprotein carrier LolA)
ProGP486 (Putative membrane protein)
ProGP485 (oprM efflux system outer membrane protein)
ProGP473 (Peptidoglycan-binding membrane protein)
ProGP429 (Maltose ABC transporter)
ProGP385 (Cj0983 (Putative lipoprotein))
ProGP373 (Putative periplasmic protein)
ProGP372 (Putative periplasmic protein)
ProGP371 (Putative secreted protease)
ProGP370 (Putative exporting protein)
ProGP369 (Putative membrane protein)
ProGP368 (Colicin V production protein)
ProGP367 (Putative uncharacterized protein)
ProGP366 (UPF0323 lipoprotein Cj0371)
ProGP374 (Putative integral membrane protein)
ProGP375 (Putative OmpA family membrane protein)
ProGP376 (Putative outer membrane efflux protein)
ProGP384 (Cj0982c (Putative amino acid transporter periplasmic solute-binding protein CjaA))
ProGP383 (Uncharacterized metallophosphoesterase)
ProGP382 (Putative secreted transglycosylase)
ProGP381 (Cj0783 (Periplasmic nitrate reductase small subunit))
ProGP380 (Putative periplasmic protein)
ProGP379 (Cj0652 (Penicillin-binding protein))
ProGP378 (Putative membrane protein)
ProGP377 (Putative periplasmic protein)
ProGP365 (Cj0366c (Inner membrane multidrug efflux system protein CmeB))
ProGP364 (Putative integral membrane protein)
ProGP352 (Putative cell division protein)
ProGP351 (BF0810)
ProGP350 (TF2339)
ProGP349 (TF1259)
ProGP348 (TfsB (S-layer protein))
ProGP347 (Spermidine/putrescine-binding protein (PotD))
ProGP346 (Chondroitinase ABC)
ProGP345 (Mfa1 (67 kDa minor fimbrillin))
ProGP353 (Putative exported protein)
ProGP354 (Putative non-specific DNA-binding protein)
ProGP355 (Cj0017c (Disulfide bond formation protein))
ProGP363 (Cj0277 (Rod shape-determining protein))
ProGP362 (Putative sulfatase family protein)
ProGP361 (Putative mechanosensitive ion channel family protein)
ProGP360 (Cj0235c (Putative protein export protein))
ProGP359 (Putative membrane protein)
ProGP358 (Putative membrane protein)
ProGP357 (Putative lipoprotein)
ProGP356 (Cj0081 (Cytochrome bd oxidase subunit I))
ProGP344 (SlaA (S-layer protein))
ProGP386 (Putative mechanosensitive ion channel family protein)
ProGP428 (Protease)
ProGP416 (Putative Uncharacterized Protein)
ProGP415 (Putative Uncharacterized Protein)
ProGP414 (Putative Uncharacterized Protein)
ProGP413 (Putative Uncharacterized Protein)
ProGP412 (OmpA/MotB)
ProGP411 (FTL_1096)
ProGP410 (DsbA)
ProGP409 (FliC (Flagellin))
ProGP417 (Putative Uncharacterized Protein)
ProGP418 (Putative Uncharacterized Protein)
ProGP419 (PilA)
ProGP427 (Hypothetical protein)
ProGP426 (Oligopeptide binding protein)
ProGP425 (ABC Transporter (TreS))
ProGP424 (Dipeptide ABC transporter, periplasmic dipeptide binding protein (dppA))
ProGP423 (AniA)
ProGP422 (LafA (Lateral flagellin))
ProGP421 (FlaB (Polar flagellin))
ProGP420 (FlaA (Polar flagellin))
ProGP408 (FliC (Flagellin))
ProGP407 (EhaJ (autotranporter))
ProGP395 (Cj1565c (Paralyzed flagellum protein))
ProGP394 (Cj1444c (Capsule polysaccharide export system periplasmic protein))
ProGP393 (Putative integral membrane protein)
ProGP392 (Putative periplasmic protein)
ProGP391 (Cj1126c (Oligosaccharyltransferase))
ProGP390 (Putative sulfatase protein)
ProGP389 (Putative integral membrane protein)
ProGP388 (Cj1032 (Membrane fusion component multidrug efflux system))
ProGP396 (Putative periplasmic protein)
ProGP397 (Possible ABC transport system permease)
ProGP398 (Lectin LecB)
ProGP406 (TF1056)
ProGP405 (TF0091)
ProGP404 (FlaB (Flagellin))
ProGP403 (FlaA (Flagellin))
ProGP402 (Glycocin F)
ProGP401 (Plantaricin ASM1)
ProGP400 (Sublancin)
ProGP399 (TfsA (S-layer protein))
ProGP387 (Putative cytochrome c biogenesis protein)
ProGP642 (Cytochrome c assembly protein)
ProGP630 (Hypothetical protein)
ProGP629 (ATPase)
ProGP628 (ABC transporter substrate binding protein)
ProGP627 (Hypothetical protein)
ProGP626 (Serpin)
ProGP625 (Hypothetical protein)
ProGP624 (Branched chain amino acid ABC transporter substrate binding protein)
ProGP623 (Hypothetical protein)
ProGP631 (ABC transporter)
ProGP632 (ABC transporter substrate binding protein)
ProGP633 (Hypothetical protein)
ProGP641 (Hypothetical protein)
ProGP640 (Primosomal protein)
ProGP639 (ABC transporter periplasmic binding protein)
ProGP638 (Excisionase)
ProGP637 (Cytochrome c biogenesis protein)
ProGP636 (NosD)
ProGP635 (TRAP ABC transporter)
ProGP634 (Peptide ABC transporter permease)
ProGP622 (NADH-ubiquinone oxidoreductase)
ProGP621 (Sugar binding protein)
ProGP609 (Hypothetical protein)
ProGP608 (Sugar ABC transporter substrate binding protein)
ProGP607 (Geranylgeranyl reductase)
ProGP606 (ABC transporter substrate binding protein)
ProGP605 (Hypothetical protein branched chain amino acid ABC transporter substrate binding protein
ProGP604 (Iron ABC transporter substrate binding protein)
ProGP603 (ABC transporter substrate binding protein)
ProGP602 (FAD-dependent oxidoreductase)
ProGP610 (Hypothetical protein)
ProGP611 (Phosphate starvation protein PhoH)
ProGP612 (ABC transporter)
ProGP620 (Hypothetical protein)
ProGP619 (Hypothetical protein)
ProGP618 (Hypothetical protein)
ProGP617 (Nodulation efficiency protein NfeD)
ProGP616 (NADH dehydrogenase subunit D)
ProGP615 (Hypothetical protein)
ProGP614 (Glutamate dehydrogenase)
ProGP613 (Nitrous oxidase accessory protein)
ProGP601 (Transglutaminase)
ProGP643 (Glycosyltransferase)
ProGP685 (Cnm)
ProGP673 (FHA domain containing protein)
ProGP672 (Hypothetical protein)
ProGP671 (Hypothetical protein)
ProGP670 (Hypothetical protein)
ProGP669 (ABC transporter)
ProGP668 (Hypothetical protein)
ProGP667 (V-type ATP synthase subunit E)
ProGP666 (ABC transporter)
ProGP674 (Hypothetical protein)
ProGP675 (Hypothetical protein)
ProGP676 (Hypothetical protein)
ProGP684 (WpaA)
ProGP683 (Flagellin)
ProGP682 (Flagellin)
ProGP681 (Formate dehydrogenase)
ProGP680 (Peptidase S8)
ProGP679 (Nitrate reductase alpha subunit)
ProGP678 (Hypothetical protein)
ProGP677 (Hypothetical protein)
ProGP665 (ABC transporter)
ProGP664 (V-type ATPase subunit D)
ProGP652 (Amino acid ABC transporter substrate binding protein)
ProGP651 (4Fe-4S ferredoxin)
ProGP650 (Hypothetical protein)
ProGP649 (Transcriptional regulator)
ProGP648 (Nitrate reductase)
ProGP647 (Hypothetical protein)
ProGP646 (Glycosyltransferase)
ProGP645 (ABC transporter substrate binding protein)
ProGP653 (Hypothetical protein)
ProGP654 (SCO1/SenC)
ProGP655 (Hypothetical protein)
ProGP663 (Protein disulfide isomerase like protein)
ProGP662 (30S ribosomal protein S2)
ProGP661 (Eight cysteine cluster domain containing protein)
ProGP660 (Hypothetical protein)
ProGP659 (Hypothetical protein)
ProGP658 (Hypothetical protein)
ProGP657 (Transcriptional regulator)
ProGP656 (RNA methyltransferase)
ProGP644 (Hypothetical protein)
ProGP600 (Hypothetical protein)
ProGP556 (Arabinase)
ProGP544 (Flagellin A2)
ProGP543 (Flagellin A1)
ProGP542 (Translation elongation factor P (EF-P))
ProGP541 (FtsL)
ProGP540 (Probable peptidase transmembrane protein)
ProGP539 (PilA)
ProGP538 (Probable transmembrane protein)
ProGP537 (Peptidyl-prolyl cis-trans isomerase)
ProGP545 (Pilin A1)
ProGP546 (Pilin A2)
ProGP547 (Pilin A3)
ProGP555 (Hypothetical protein)
ProGP554 (Hypothetical protein)
ProGP553 (Hypothetical protein)
ProGP552 (Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96)
ProGP551 (Pls (Plasmin sensitive surface protein))
ProGP550 (Pls (Plasmin sensitive surface protein))
ProGP549 (Pilin A6)
ProGP548 (Pilin A4)
ProGP536 (Probable transmembrane protein)
ProGP535 (Probable lipoprotein)
ProGP523 (Probable lipoprotein transmembrane)
ProGP522 (Putative membrane fusion protein)
ProGP521 (EF-P)
ProGP520 (Hag flagellin)
ProGP519 (Slg2 (S-layer glycoprotein))
ProGP518 (Slg1 (S-layer glycoprotein))
ProGP517 (CcoP)
ProGP516 (C5)
ProGP524 (Probable transmembrane protein)
ProGP525 (Hypothetical signal peptide protein)
ProGP526 (RagB)
ProGP534 (PilN)
ProGP533 (Probable m20-related peptidase)
ProGP532 (Probable serine protease protein)
ProGP531 (Probable transmembrane protein)
ProGP530 (D-(−)-3-hydroxybutyrate oligomer hydrolase)
ProGP529 (AcrA)
ProGP528 (FtsN)
ProGP527 (Probable tpr domain signal peptide protein)
ProGP515 (NirK)
ProGP557 (Hypothetical protein)
ProGP599 (Hypothetical protein)
ProGP587 (Chloride channel protein)
ProGP586 (Hypothetical protein)
ProGP585 (Hypothetical protein)
ProGP584 (Hypothetical protein)
ProGP583 (ATP synthase subunit A)
ProGP582 (Metallophosphoesterase)
ProGP581 (Cytochrome c assembly)
ProGP580 (Histidine kinase)
ProGP588 (Hypothetical protein)
ProGP589 (Thermosome subunit)
ProGP590 (Hypothetical protein)
ProGP598 (Peptidase M50)
ProGP597 (Hypothetical protein)
ProGP596 (Nitrate reductase beta subunit)
ProGP595 (Glycosyl transferase)
ProGP594 (ABC transporter substrate binding protei
ProGP593 (Hypothetical protein)
ProGP592 (Peptidase)
ProGP591 (Peptide ABC transporter substrate bindin protein)
ProGP579 (Hypothetical protein)
ProGP578 (Cytochrome c biogenesis protein)
ProGP566 (Multidrug RND transporter)
ProGP565 (Peptide binding protein)
ProGP564 (Hypothetical protein)
ProGP563 (Pullulanase)
ProGP562 (Hypothetical protein)
ProGP561 (Hypothetical protein)
ProGP560 (Hypothetical protein)
ProGP559 (Pullulanase)
ProGP567 (Molybdopterin oxidoreductase)
ProGP568 (Cytochrome c biogenesis protein)
ProGP569 (Hypothetical protein)
ProGP577 (Nitric-oxide reductase large subunit)
ProGP576 (Penicillin amidase)
ProGP575 (Hypothetical protein)
ProGP574 (Peptide transporter)
ProGP573 (Hypothetical protein)
ProGP572 (Hypothetical protein)
ProGP571 (Hypothetical protein)
ProGP570 (Peptide transporter)
ProGP558 (ABC transporter substrate binding protei
ProGP343 (PilA (FTH_0384))
ProGP128 (wmA (S-layer protein))
ProGP116 (Endo-β-N-acetylglucosaminidase F3)
ProGP115 (Flavastacin (P40))
ProGP114 (Endo-β-N-acetylglucosaminidase F2)
ProGP113 (Flagellin Laf1)
ProGP112 (72-kDa glycoprotein (ExsJ))
ProGP111 (S-layer glycoprotein)
ProGP110 (45 to 47-kDa protein)
ProGP109 (Stable protease)
ProGP117 (Cell surface glycoprotein (S-layer protein))
ProGP118 (Flagellin)
ProGP119 (Fimbrial protein (pilin))
ProGP127 (Flagellin B1 (41 kDa))
ProGP126 (31/33 kDa flagellin)
ProGP125 (Flagellin)
ProGP124 (β-1,4-mannanase)
ProGP123 (CRX (Copper response extracellular protein))
ProGP122 (Surface layer glycoprotein SatA)
ProGP121 (Surface layer glycoprotein Sat B)
ProGP120 (Protein A (cell wall glycoprotein))
ProGP108 (Tetrabrachion (S layer glycoprotein))
ProGP107 (Fimbrial protein (pilin); (group I T4P))
ProGP95 (S-layer glycoprotein)
ProGP94 (Surface layer glycoprotein)
ProGP93 (Protein complex)
ProGP92 (Anitigen (1000 kDa protein))
ProGP91 (S-layer glycoprotein (82 kDa))
ProGP90 (Antigens)
ProGP89 (Surface layer glycoprotein)
ProGP88 (S-layer glycoprotein)
ProGP96 (PS2 (S-layer glycoprotein))
ProGP97 (27kDa flagellin)
ProGP98 (32kDa flagellin)
ProGP106 (Heparin lyase I or Heparinase I)
ProGP105 (S-layer glycoprotein)
ProGP104 (S-layer glycoprotein (138 kDa))
ProGP103 (Flagellin B2)
ProGP102 (Flagellin B1)
ProGP101 (H(A16-M) (1,3-1,4)-beta-glucanase)
ProGP100 (PF sheath protein (44 kDa))
ProGP99 (PilE (pilin))
ProGP87 (Cellulase (30 kDa) and Xylanase (15.7 kDa))
ProGP129 (RU 41740-P1 Glyoprotein fraction (non endotoxin))
ProGP171 (Man26A (b-mannosidase 26A))
ProGP159 (FlaB (flagellar core protein))
ProGP158 (FlaB (flagellar core protein))
ProGP157 (HBHA (heparin-binding hemagglutinin))
ProGP156 (AnAF)
ProGP155 (Flagellin)
ProGP154 (Flagellin)
ProGP153 (Flagellin)
ProGP152 (Type A Flagellin)
ProGP160 (Flagellar filament 31.3 kDa core protein
ProGP161 (FlaB (flagellar core protein))
ProGP162 (FlaB (flagellar core protein))
ProGP170 (Cysteine proteases (extracellular) Arg-gingipains (RgpA))
ProGP169 (Surface layer glycoproteins)
ProGP168 (Slp (S-layer glycoprotein))
ProGP167 (BclA (collagen-like protein))
ProGP166 (Chondroitinase-B)
ProGP165 (S-layer glycopeptide)
ProGP164 (FlaB (flagellar core protein))
ProGP163 (FlaB (flagellar core protein))
ProGP151 (P 110 (Adhesin-like glycoprotein 110 kDa))
ProGP150 (Cytochrome b558/566 subunit A (b type hemoprotein))
ProGP138 (Cell surface glycoprotein)
ProGP137 (Oscillin (65.8 kDa))
ProGP136 (Antigen (60 kDa))
ProGP135 (37-kDa protein)
ProGP134 (Exopolymer)
ProGP133 (Heparinase II)
ProGP132 (Chondroitinase-AC)
ProGP131 (Cell surface phosphatase)
ProGP139 (S-layer glycoprotein)
ProGP140 (α-Glucosidase (thermostable) 160 kDa)
ProGP141 (PGP)
ProGP149 (Crystal toxin (66 kDa))
ProGP148 (β-1,4-mannanase (G-enzyme))
ProGP147 (S-layer glycoprotein (29 kDa, forms tetramer))
ProGP146 (Flagellin)
ProGP145 (Adhesion inhibitor)
ProGP144 (S-layer glycoprotein (120 kDa))
ProGP143 (S-layer glycoprotein (101 kDa))
ProGP142 (Antifreeze protein)
ProGP130 (Pyrolysin)
ProGP86 (Cellulase complex (230 kDa subunit))
ProGP42 (Cellobiosidase)
ProGP30 (Flagellin B1)
ProGP29 (Flagellin A2)
ProGP28 (Flagellin A1)
ProGP27 (Cex (Exoglucanase or xylanase))
ProGP26 (CenA (Endoglucanase A))
ProGP25 (33 and 34 kDa antigens)
ProGP24 (Flagellin FlaB3)
ProGP23 (Flagellin FlaB2)
ProGP31 (Flagellin B2)
ProGP32 (Flagellin B3)
ProGP33 (Streptococcal acid glycoprotein SAGP)
ProGP41 (HPI (hexagonally packed intermediate) layer polypepetide)
ProGP40 (Long-fibril protein (LFP))
ProGP39 (Acidic glycoproteins (133-155 kDa))
ProGP38 (VGP (74 kDa))
ProGP37 (S-layer glycoprotein)
ProGP36 (S-layer glycoprotein)
ProGP35 (β-1,4-Endoglucanases)
ProGP34 (S-layer glycoprotein)
ProGP22 (Flagellin FlaB1)
ProGP21 (Outer membrane protein (75 kDa))
ProGP9 (8 kDa fimbrae)
ProGP8 (Membrane glycoprotein 152 kDa )
ProGP7 (Cellulase CB)
ProGP6 (Cellulase CA)
ProGP5 (Factor PG-1)
ProGP4 (F-pilin)
ProGP3 (S-layer glycoprotein)
ProGP2 (Phytotoxin)
ProGP10 (Flagellin)
ProGP11 (Autolysin (28 kDa))
ProGP12 (12 kDa antigen)
ProGP20 (Outer membrane protein (50 kDa))
ProGP19 (Outer membrane protein (26.5 kDa))
ProGP18 (S-layer glycoprotein SgsE)
ProGP17 (Flagellin)
ProGP16 (50 kDa antigen)
ProGP15 (N-acetylmuramoylhydrolase (Muramidase-2))
ProGP14 (Membrane glycoprotein)
ProGP13 (33 kDa antigen)
ProGP1 (Envelope specific glycoprotein)
ProGP43 (SlgA (cell surface glycoprotein))
ProGP85 (Auracyanin-B2 (18 kDa))
ProGP73 (p115/ PAAP)
ProGP72 (Alkaline Phosphatase D)
ProGP71 (S-layer glycoprotein)
ProGP70 ((1,3-1,4)-beta-glucanase (MAC))
ProGP69 (S-layer glycoprotein)
ProGP68 (S-layer glycoprotein)
ProGP67 (35 kDa flagellin)
ProGP66 (25 kDa flagellin)
ProGP74 (H(A107-M) (1,3-1,4)-beta-glucanase)
ProGP75 (S-layer glycoprotein)
ProGP76 (Cell surface lipoprotein MPB83 (25/23-kDa antigen))
ProGP84 (Auracyanin-B1 (22 kDa))
ProGP83 (Ice nucleation lipoglycoprotein)
ProGP82 (Ice nucleation lipoglycoprotein)
ProGP81 (S-layer glycoprotein)
ProGP80 (S-layer glycoprotein (115 kDa protein))
ProGP79 (S-layer glycoprotein)
ProGP78 (Cell surface glycoprotein (SlgA))
ProGP77 (Major outer membrane protein (MOMP, 40 kD))
ProGP65 (24 kDa flagellin)
ProGP64 (15 kDa-phosphate containing glycoprotein)
ProGP52 (Hypothetical protein)
ProGP51 (Alanine and proline-rich secreted protein Apa (50/55-kDa or 45 kDa MPT 32))
ProGP50 (Flagellin A)
ProGP49 (S-layer glycoprotein)
ProGP48 (S-layer glycoprotein)
ProGP47 (S-layer glycoprotein (92 kDa))
ProGP46 (S-layer glycoprotein (90 kDa))
ProGP45 (S-layer glycoprotein (94 kDa))
ProGP53 (33 kDa minor core flagellin)
ProGP54 (34 kDa major core flagellin)
ProGP55 (Cell surface protein/S-layer protein)
ProGP63 (Xylanase B (Endo-1,4-beta-xylanase B))
ProGP62 (18 kDa and 32 kDa lectin binding proteins
ProGP61 (S-layer glycoprotein (132 kDa))
ProGP60 (S-layer glycoprotein (118 kDa))
ProGP59 (β-1, 4-D-glucosidase (51 kDa))
ProGP58 (Thermopsin)
ProGP57 (38 kDa antigen)
ProGP56 (Cellulolosome complex (Cellulosomal-scaffolding protein A))
ProGP44 (S-layer glycoprotein)
ProGP299 (CcoP)
ProGP287 (PstS3)
ProGP286 (PstS2)
ProGP285 (PpiB)
ProGP284 (PonA2)
ProGP283 (OppA)
ProGP282 (prG)
ProGP281 (LprF)
ProGP280 (LpqW (lipoprotein))
ProGP288 (Rv0020c)
ProGP289 (Rv0281)
ProGP290 (Rv0907)
ProGP298 (FliC (Flagellin subunit))
ProGP297 (FlaB (Flagellin))
ProGP296 (FlaA (Flagellin))
ProGP295 (Thioredoxin)
ProGP294 (Secreted protease)
ProGP293 (Rv2813)
ProGP292 (Rv1084)
ProGP291 (Rv0988)
ProGP279 (LpqT (putative lipoprotein))
ProGP278 (LpqN)
ProGP266 (LprA)
ProGP265 (Rv2799)
ProGP264 (Glycosyl hydrolase)
ProGP263 (Rv3491)
ProGP262 (Pillin (Group IV))
ProGP261 (Flagellin (FlaA))
ProGP260 (FlaB2)
ProGP259 (FlaB1)
ProGP267 (GgtB)
ProGP268 (BfrB)
ProGP269 (Bglu)
ProGP277 (LpqI)
ProGP276 (LpqF lipoprotein)
ProGP275 (LpqB lipoprotein)
ProGP274 (LppZ (Putative lipoprotein))
ProGP273 (LppX (Putative lipoprotein))
ProGP272 (LppL)
ProGP271 (FecB)
ProGP270 (BlaC)
ProGP258 (FlaB3)
ProGP300 (CycB)
ProGP342 (FTH_0357)
ProGP330 (FTH_0159)
ProGP329 (FTH_1830)
ProGP328 (Extracellular matrix protein adhesin A (EmaA))
ProGP327 (LccA, an Archaeal Laccase)
ProGP326 (FliC (Flagellin))
ProGP325 (FliC (Flagellin))
ProGP324 (FliC (Flagellin))
ProGP323 (JlpA (42-45 kDa antigen))
ProGP331 (FTH_1855)
ProGP332 (FTH_0539)
ProGP333 (FTH_1112)
ProGP341 (FTH_0414)
ProGP340 (FTH_1071)
ProGP339 (FTH_0069)
ProGP338 (FTH_1293)
ProGP337 (FTH_1721)
ProGP336 (FTH_1761)
ProGP335 (FTH_1167)
ProGP334 (FTH_0311)
ProGP322 (EtpA Adhesin)
ProGP321 (OmpA)
ProGP309 (PstS (40 kDa))
ProGP308 (Sco)
ProGP307 (PotF)
ProGP306 (Mip (Peptidyl-prolyl cis-trans isomerase
ProGP305 (Laz)
ProGP304 (Gna1946)
ProGP303 (DsbA)
ProGP302 (AniA)
ProGP310 (Hypothetical protein)
ProGP311 (BF2494)
ProGP312 (Hypothetical protein)
ProGP320 (LppC)
ProGP319 (BF0935)
ProGP318 (BF3918)
ProGP317 (BF3567)
ProGP316 (Srr1)
ProGP315 (Putative outer membrane protein)
ProGP314 (Putative exported protein)
ProGP313 (Hypothetical protein)
ProGP301 (S-layer Protein)
ProGP257 (Microcystin-related protein C (MrpC))
ProGP213 (95-kDa glycoprotein)
ProGP201 (Diffuse Adherence Adhesin (AIDA-I))
ProGP200 (Laminin-binding glycoprotein (MS-LBP) or histone-like protein)
ProGP199 (Flagellin)
ProGP198 (Flagellin)
ProGP197 (Subtilisin (SBL)-Cys mutant)
ProGP196 (ComP)
ProGP195 (Streptococcal acid glycoprotein SAGP)
ProGP194 (PS4A (water soluble protein-polysaccharide))
ProGP202 (TMBP (Trehalose/maltose binding protein)
ProGP203 (Cell envelope glycoprotein)
ProGP204 (CbtA (Cellobiose binding protein)
ProGP212 (MDBP (Maltodextrin binding protein))
ProGP211 (TMBP (Trehalose/maltose binding protein)
ProGP210 (Protein-serine/threonine kinase (SsoPK1)
ProGP209 (Fap1 (Fimbrial adhesin))
ProGP208 (SbsD (S-layer glycoprotein))
ProGP207 (Glycopeptidolipid (GPL))
ProGP206 (Flagellin (FlaA))
ProGP205 (Flagellin A (FlaA))
ProGP193 (PstS1)
ProGP192 (LpqH)
ProGP180 (S-layer glycoprotein (27 kDa))
ProGP179 (S-layer glycoprotein)
ProGP178 (mtRgpA)
ProGP177 (HRgpA)
ProGP176 (TibA (outer membrane protein synthesized as preTibA))
ProGP175 (Flagellin B)
ProGP174 (Flagellin A)
ProGP173 (GBP (Glucose binding protein)/GlcS)
ProGP181 (P140 (140 kDa protein))
ProGP182 (P120 (120 kDa protein))
ProGP183 (GlnH)
ProGP191 (LppQ lipoprotein)
ProGP190 (LppN lipoprotein)
ProGP189 (Superoxide dismutase [Cu-Zn])
ProGP188 (flaB)
ProGP187 (flaA)
ProGP186 (98-kDa ,58-kDa, 54-kDa glycoproteins)
ProGP185 (Invertase)
ProGP184 (Mpt83 (Cell surface lipoprotein))
ProGP172 (S-layer glycoprotein)
ProGP214 (Flagellin B)
ProGP256 (CmeC)
ProGP244 (SrpA)
ProGP243 (Synthetic Glycopeptide)
ProGP242 (S-layer protein)
ProGP241 (FlaA)
ProGP240 (FlaB3)
ProGP239 (FlaB2)
ProGP238 (FlaB1)
ProGP237 (SgtA)
ProGP245 (SraP (serine-rich adhesin for platelets)
ProGP246 (BclB (collagen-like protein))
ProGP247 (Flagellin A)
ProGP255 (HmcA)
ProGP254 (Dps (18 kDa), Stress inducible DNA binding protein)
ProGP253 (DgpC)
ProGP252 (DgpA)
ProGP251 (Type b Flagellin)
ProGP250 (PilA (Pilin))
ProGP249 (Ag43α (Antigen 43 passenger domain))
ProGP248 (Flagellin B)
ProGP236 (HisJ)
ProGP235 (CipB (putative dipeptide-binding protein
ProGP223 (ZnuA)
ProGP222 (PEB3)
ProGP221 (Cj1496c)
ProGP220 (Cj0200c)
ProGP219 (Cj0114)
ProGP218 (CgpA)
ProGP217 (AcrA or CmeA)
ProGP216 (BclA (collagen-like protein))
ProGP224 (Flagellin)
ProGP225 (Flagellin)
ProGP226 (Flagellin)
ProGP234 (CipA (conserved hypothetical protein))
ProGP233 (Resuscitation promoting factor 2 (Rpf2))
ProGP232 (Flagellin FlaA)
ProGP231 (VirB10 protein)
ProGP230 (PilA (Type IV pilin))
ProGP229 (GspB)
ProGP228 (Short glycopeptides)
ProGP227 (HMW1 (Adhesin))
ProGP215 (Flagellin A (FlaA))
Compare ID
Choose Compare Id
ProGP471 (Putative uncharacterized protein)
ProGP459 (ABC-type amino acid transport system secreted component)
ProGP458 (ThuA)
ProGP457 (LppO (Putative lipoprotein))
ProGP456 (Rv3835)
ProGP455 (35kDa protein)
ProGP454 (Rv1887)
ProGP453 (Probable conserved MCE associated membrane protein)
ProGP452 (Probable conserved proline rich membrane protein (MT2222))
ProGP460 (Putative protein)
ProGP461 (Putative uncharacterized protein)
ProGP462 (Putative uncharacterized protein)
ProGP470 (Putative uncharacterized protein)
ProGP469 (MdtA multidrug resistance protein)
ProGP468 (C-terminal protease)
ProGP467 (Alanine and proline-rich secreted protei
ProGP466 (Putative protein)
ProGP465 (Immunogenic protein MPT63)
ProGP464 (Putative protein)
ProGP463 (Immunogenic protein MPT63)
ProGP451 (COK_1394)
ProGP450 (AtaC)
ProGP438 (DnaK)
ProGP437 (FliC (Type B Flagellin))
ProGP436 (Acm2)
ProGP435 (FasC (fasciclin domain protein))
ProGP434 (Arabinose ABC transporter, arabinose binding protein (AraS))
ProGP433 (Hypothetical protein)
ProGP432 (Hypothetical protein)
ProGP431 (Hypothetical protein)
ProGP439 (Lp_2260)
ProGP440 (Lp_2162)
ProGP441 (Lp_1643)
ProGP449 (PsrP (Adhesin))
ProGP448 (MOMP)
ProGP447 (FtsZ)
ProGP446 (Lp_3421)
ProGP445 (FtsK1)
ProGP444 (Lp_ 2793)
ProGP443 (FtsY)
ProGP442 (PdhC)
ProGP430 (Serine protease)
ProGP472 (Putative signal peptide)
ProGP514 (EmaA)
ProGP502 (Uncharacterized protein)
ProGP501 (Uncharacterized protein)
ProGP500 (Uncharacterized protein)
ProGP499 (Uncharacterized protein)
ProGP498 (Uncharacterized protein)
ProGP497 (Putative secretion protein)
ProGP496 (PliA)
ProGP495 (EF-P)
ProGP503 (Uncharacterized protein)
ProGP504 (Uncharacterized protein)
ProGP505 (Laz (lipid-modified azurin))
ProGP513 (Knh)
ProGP512 (Enterocin F4-9)
ProGP511 (Translation elongation factor P (EF-P))
ProGP510 (Translation elongation factor P (EF-P))
ProGP509 (Ccop)
ProGP508 (Mip (Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA))
ProGP507 (Sco)
ProGP506 (MetQ)
ProGP494 (FliC (Flagellin))
ProGP493 (CN)
ProGP481 (CpxP-like protein)
ProGP480 (Putative fusaric acid resistance transporter protein)
ProGP479 (Putative lipoprotein)
ProGP478 (Putative uncharacterized protein)
ProGP477 (Putative cell division related protein)
ProGP476 (Putative MCE (mammalian cell entry) related protein)
ProGP475 (Putative uncharacterized protein)
ProGP474 (Putative phospholipid-binding lipoprotei
ProGP482 (ComEA)
ProGP483 (Putative PRC barrel containing lipoprote
ProGP484 (Putative exported protein)
ProGP492 (Type IV Pilin)
ProGP491 (Putative uncharacterized protein)
ProGP490 (OmpA family protein)
ProGP489 (Cell division protein)
ProGP488 (OmlA)
ProGP487 (OM lipoprotein carrier LolA)
ProGP486 (Putative membrane protein)
ProGP485 (oprM efflux system outer membrane protein)
ProGP473 (Peptidoglycan-binding membrane protein)
ProGP429 (Maltose ABC transporter)
ProGP385 (Cj0983 (Putative lipoprotein))
ProGP373 (Putative periplasmic protein)
ProGP372 (Putative periplasmic protein)
ProGP371 (Putative secreted protease)
ProGP370 (Putative exporting protein)
ProGP369 (Putative membrane protein)
ProGP368 (Colicin V production protein)
ProGP367 (Putative uncharacterized protein)
ProGP366 (UPF0323 lipoprotein Cj0371)
ProGP374 (Putative integral membrane protein)
ProGP375 (Putative OmpA family membrane protein)
ProGP376 (Putative outer membrane efflux protein)
ProGP384 (Cj0982c (Putative amino acid transporter periplasmic solute-binding protein CjaA))
ProGP383 (Uncharacterized metallophosphoesterase)
ProGP382 (Putative secreted transglycosylase)
ProGP381 (Cj0783 (Periplasmic nitrate reductase small subunit))
ProGP380 (Putative periplasmic protein)
ProGP379 (Cj0652 (Penicillin-binding protein))
ProGP378 (Putative membrane protein)
ProGP377 (Putative periplasmic protein)
ProGP365 (Cj0366c (Inner membrane multidrug efflux system protein CmeB))
ProGP364 (Putative integral membrane protein)
ProGP352 (Putative cell division protein)
ProGP351 (BF0810)
ProGP350 (TF2339)
ProGP349 (TF1259)
ProGP348 (TfsB (S-layer protein))
ProGP347 (Spermidine/putrescine-binding protein (PotD))
ProGP346 (Chondroitinase ABC)
ProGP345 (Mfa1 (67 kDa minor fimbrillin))
ProGP353 (Putative exported protein)
ProGP354 (Putative non-specific DNA-binding protein)
ProGP355 (Cj0017c (Disulfide bond formation protein))
ProGP363 (Cj0277 (Rod shape-determining protein))
ProGP362 (Putative sulfatase family protein)
ProGP361 (Putative mechanosensitive ion channel family protein)
ProGP360 (Cj0235c (Putative protein export protein))
ProGP359 (Putative membrane protein)
ProGP358 (Putative membrane protein)
ProGP357 (Putative lipoprotein)
ProGP356 (Cj0081 (Cytochrome bd oxidase subunit I))
ProGP344 (SlaA (S-layer protein))
ProGP386 (Putative mechanosensitive ion channel family protein)
ProGP428 (Protease)
ProGP416 (Putative Uncharacterized Protein)
ProGP415 (Putative Uncharacterized Protein)
ProGP414 (Putative Uncharacterized Protein)
ProGP413 (Putative Uncharacterized Protein)
ProGP412 (OmpA/MotB)
ProGP411 (FTL_1096)
ProGP410 (DsbA)
ProGP409 (FliC (Flagellin))
ProGP417 (Putative Uncharacterized Protein)
ProGP418 (Putative Uncharacterized Protein)
ProGP419 (PilA)
ProGP427 (Hypothetical protein)
ProGP426 (Oligopeptide binding protein)
ProGP425 (ABC Transporter (TreS))
ProGP424 (Dipeptide ABC transporter, periplasmic dipeptide binding protein (dppA))
ProGP423 (AniA)
ProGP422 (LafA (Lateral flagellin))
ProGP421 (FlaB (Polar flagellin))
ProGP420 (FlaA (Polar flagellin))
ProGP408 (FliC (Flagellin))
ProGP407 (EhaJ (autotranporter))
ProGP395 (Cj1565c (Paralyzed flagellum protein))
ProGP394 (Cj1444c (Capsule polysaccharide export system periplasmic protein))
ProGP393 (Putative integral membrane protein)
ProGP392 (Putative periplasmic protein)
ProGP391 (Cj1126c (Oligosaccharyltransferase))
ProGP390 (Putative sulfatase protein)
ProGP389 (Putative integral membrane protein)
ProGP388 (Cj1032 (Membrane fusion component multidrug efflux system))
ProGP396 (Putative periplasmic protein)
ProGP397 (Possible ABC transport system permease)
ProGP398 (Lectin LecB)
ProGP406 (TF1056)
ProGP405 (TF0091)
ProGP404 (FlaB (Flagellin))
ProGP403 (FlaA (Flagellin))
ProGP402 (Glycocin F)
ProGP401 (Plantaricin ASM1)
ProGP400 (Sublancin)
ProGP399 (TfsA (S-layer protein))
ProGP387 (Putative cytochrome c biogenesis protein)
ProGP642 (Cytochrome c assembly protein)
ProGP630 (Hypothetical protein)
ProGP629 (ATPase)
ProGP628 (ABC transporter substrate binding protein)
ProGP627 (Hypothetical protein)
ProGP626 (Serpin)
ProGP625 (Hypothetical protein)
ProGP624 (Branched chain amino acid ABC transporter substrate binding protein)
ProGP623 (Hypothetical protein)
ProGP631 (ABC transporter)
ProGP632 (ABC transporter substrate binding protein)
ProGP633 (Hypothetical protein)
ProGP641 (Hypothetical protein)
ProGP640 (Primosomal protein)
ProGP639 (ABC transporter periplasmic binding protein)
ProGP638 (Excisionase)
ProGP637 (Cytochrome c biogenesis protein)
ProGP636 (NosD)
ProGP635 (TRAP ABC transporter)
ProGP634 (Peptide ABC transporter permease)
ProGP622 (NADH-ubiquinone oxidoreductase)
ProGP621 (Sugar binding protein)
ProGP609 (Hypothetical protein)
ProGP608 (Sugar ABC transporter substrate binding protein)
ProGP607 (Geranylgeranyl reductase)
ProGP606 (ABC transporter substrate binding protein)
ProGP605 (Hypothetical protein branched chain amino acid ABC transporter substrate binding protein
ProGP604 (Iron ABC transporter substrate binding protein)
ProGP603 (ABC transporter substrate binding protein)
ProGP602 (FAD-dependent oxidoreductase)
ProGP610 (Hypothetical protein)
ProGP611 (Phosphate starvation protein PhoH)
ProGP612 (ABC transporter)
ProGP620 (Hypothetical protein)
ProGP619 (Hypothetical protein)
ProGP618 (Hypothetical protein)
ProGP617 (Nodulation efficiency protein NfeD)
ProGP616 (NADH dehydrogenase subunit D)
ProGP615 (Hypothetical protein)
ProGP614 (Glutamate dehydrogenase)
ProGP613 (Nitrous oxidase accessory protein)
ProGP601 (Transglutaminase)
ProGP643 (Glycosyltransferase)
ProGP685 (Cnm)
ProGP673 (FHA domain containing protein)
ProGP672 (Hypothetical protein)
ProGP671 (Hypothetical protein)
ProGP670 (Hypothetical protein)
ProGP669 (ABC transporter)
ProGP668 (Hypothetical protein)
ProGP667 (V-type ATP synthase subunit E)
ProGP666 (ABC transporter)
ProGP674 (Hypothetical protein)
ProGP675 (Hypothetical protein)
ProGP676 (Hypothetical protein)
ProGP684 (WpaA)
ProGP683 (Flagellin)
ProGP682 (Flagellin)
ProGP681 (Formate dehydrogenase)
ProGP680 (Peptidase S8)
ProGP679 (Nitrate reductase alpha subunit)
ProGP678 (Hypothetical protein)
ProGP677 (Hypothetical protein)
ProGP665 (ABC transporter)
ProGP664 (V-type ATPase subunit D)
ProGP652 (Amino acid ABC transporter substrate binding protein)
ProGP651 (4Fe-4S ferredoxin)
ProGP650 (Hypothetical protein)
ProGP649 (Transcriptional regulator)
ProGP648 (Nitrate reductase)
ProGP647 (Hypothetical protein)
ProGP646 (Glycosyltransferase)
ProGP645 (ABC transporter substrate binding protein)
ProGP653 (Hypothetical protein)
ProGP654 (SCO1/SenC)
ProGP655 (Hypothetical protein)
ProGP663 (Protein disulfide isomerase like protein)
ProGP662 (30S ribosomal protein S2)
ProGP661 (Eight cysteine cluster domain containing protein)
ProGP660 (Hypothetical protein)
ProGP659 (Hypothetical protein)
ProGP658 (Hypothetical protein)
ProGP657 (Transcriptional regulator)
ProGP656 (RNA methyltransferase)
ProGP644 (Hypothetical protein)
ProGP600 (Hypothetical protein)
ProGP556 (Arabinase)
ProGP544 (Flagellin A2)
ProGP543 (Flagellin A1)
ProGP542 (Translation elongation factor P (EF-P))
ProGP541 (FtsL)
ProGP540 (Probable peptidase transmembrane protein)
ProGP539 (PilA)
ProGP538 (Probable transmembrane protein)
ProGP537 (Peptidyl-prolyl cis-trans isomerase)
ProGP545 (Pilin A1)
ProGP546 (Pilin A2)
ProGP547 (Pilin A3)
ProGP555 (Hypothetical protein)
ProGP554 (Hypothetical protein)
ProGP553 (Hypothetical protein)
ProGP552 (Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96)
ProGP551 (Pls (Plasmin sensitive surface protein))
ProGP550 (Pls (Plasmin sensitive surface protein))
ProGP549 (Pilin A6)
ProGP548 (Pilin A4)
ProGP536 (Probable transmembrane protein)
ProGP535 (Probable lipoprotein)
ProGP523 (Probable lipoprotein transmembrane)
ProGP522 (Putative membrane fusion protein)
ProGP521 (EF-P)
ProGP520 (Hag flagellin)
ProGP519 (Slg2 (S-layer glycoprotein))
ProGP518 (Slg1 (S-layer glycoprotein))
ProGP517 (CcoP)
ProGP516 (C5)
ProGP524 (Probable transmembrane protein)
ProGP525 (Hypothetical signal peptide protein)
ProGP526 (RagB)
ProGP534 (PilN)
ProGP533 (Probable m20-related peptidase)
ProGP532 (Probable serine protease protein)
ProGP531 (Probable transmembrane protein)
ProGP530 (D-(−)-3-hydroxybutyrate oligomer hydrolase)
ProGP529 (AcrA)
ProGP528 (FtsN)
ProGP527 (Probable tpr domain signal peptide protein)
ProGP515 (NirK)
ProGP557 (Hypothetical protein)
ProGP599 (Hypothetical protein)
ProGP587 (Chloride channel protein)
ProGP586 (Hypothetical protein)
ProGP585 (Hypothetical protein)
ProGP584 (Hypothetical protein)
ProGP583 (ATP synthase subunit A)
ProGP582 (Metallophosphoesterase)
ProGP581 (Cytochrome c assembly)
ProGP580 (Histidine kinase)
ProGP588 (Hypothetical protein)
ProGP589 (Thermosome subunit)
ProGP590 (Hypothetical protein)
ProGP598 (Peptidase M50)
ProGP597 (Hypothetical protein)
ProGP596 (Nitrate reductase beta subunit)
ProGP595 (Glycosyl transferase)
ProGP594 (ABC transporter substrate binding protei
ProGP593 (Hypothetical protein)
ProGP592 (Peptidase)
ProGP591 (Peptide ABC transporter substrate bindin protein)
ProGP579 (Hypothetical protein)
ProGP578 (Cytochrome c biogenesis protein)
ProGP566 (Multidrug RND transporter)
ProGP565 (Peptide binding protein)
ProGP564 (Hypothetical protein)
ProGP563 (Pullulanase)
ProGP562 (Hypothetical protein)
ProGP561 (Hypothetical protein)
ProGP560 (Hypothetical protein)
ProGP559 (Pullulanase)
ProGP567 (Molybdopterin oxidoreductase)
ProGP568 (Cytochrome c biogenesis protein)
ProGP569 (Hypothetical protein)
ProGP577 (Nitric-oxide reductase large subunit)
ProGP576 (Penicillin amidase)
ProGP575 (Hypothetical protein)
ProGP574 (Peptide transporter)
ProGP573 (Hypothetical protein)
ProGP572 (Hypothetical protein)
ProGP571 (Hypothetical protein)
ProGP570 (Peptide transporter)
ProGP558 (ABC transporter substrate binding protei
ProGP343 (PilA (FTH_0384))
ProGP128 (wmA (S-layer protein))
ProGP116 (Endo-β-N-acetylglucosaminidase F3)
ProGP115 (Flavastacin (P40))
ProGP114 (Endo-β-N-acetylglucosaminidase F2)
ProGP113 (Flagellin Laf1)
ProGP112 (72-kDa glycoprotein (ExsJ))
ProGP111 (S-layer glycoprotein)
ProGP110 (45 to 47-kDa protein)
ProGP109 (Stable protease)
ProGP117 (Cell surface glycoprotein (S-layer protein))
ProGP118 (Flagellin)
ProGP119 (Fimbrial protein (pilin))
ProGP127 (Flagellin B1 (41 kDa))
ProGP126 (31/33 kDa flagellin)
ProGP125 (Flagellin)
ProGP124 (β-1,4-mannanase)
ProGP123 (CRX (Copper response extracellular protein))
ProGP122 (Surface layer glycoprotein SatA)
ProGP121 (Surface layer glycoprotein Sat B)
ProGP120 (Protein A (cell wall glycoprotein))
ProGP108 (Tetrabrachion (S layer glycoprotein))
ProGP107 (Fimbrial protein (pilin); (group I T4P))
ProGP95 (S-layer glycoprotein)
ProGP94 (Surface layer glycoprotein)
ProGP93 (Protein complex)
ProGP92 (Anitigen (1000 kDa protein))
ProGP91 (S-layer glycoprotein (82 kDa))
ProGP90 (Antigens)
ProGP89 (Surface layer glycoprotein)
ProGP88 (S-layer glycoprotein)
ProGP96 (PS2 (S-layer glycoprotein))
ProGP97 (27kDa flagellin)
ProGP98 (32kDa flagellin)
ProGP106 (Heparin lyase I or Heparinase I)
ProGP105 (S-layer glycoprotein)
ProGP104 (S-layer glycoprotein (138 kDa))
ProGP103 (Flagellin B2)
ProGP102 (Flagellin B1)
ProGP101 (H(A16-M) (1,3-1,4)-beta-glucanase)
ProGP100 (PF sheath protein (44 kDa))
ProGP99 (PilE (pilin))
ProGP87 (Cellulase (30 kDa) and Xylanase (15.7 kDa))
ProGP129 (RU 41740-P1 Glyoprotein fraction (non endotoxin))
ProGP171 (Man26A (b-mannosidase 26A))
ProGP159 (FlaB (flagellar core protein))
ProGP158 (FlaB (flagellar core protein))
ProGP157 (HBHA (heparin-binding hemagglutinin))
ProGP156 (AnAF)
ProGP155 (Flagellin)
ProGP154 (Flagellin)
ProGP153 (Flagellin)
ProGP152 (Type A Flagellin)
ProGP160 (Flagellar filament 31.3 kDa core protein
ProGP161 (FlaB (flagellar core protein))
ProGP162 (FlaB (flagellar core protein))
ProGP170 (Cysteine proteases (extracellular) Arg-gingipains (RgpA))
ProGP169 (Surface layer glycoproteins)
ProGP168 (Slp (S-layer glycoprotein))
ProGP167 (BclA (collagen-like protein))
ProGP166 (Chondroitinase-B)
ProGP165 (S-layer glycopeptide)
ProGP164 (FlaB (flagellar core protein))
ProGP163 (FlaB (flagellar core protein))
ProGP151 (P 110 (Adhesin-like glycoprotein 110 kDa))
ProGP150 (Cytochrome b558/566 subunit A (b type hemoprotein))
ProGP138 (Cell surface glycoprotein)
ProGP137 (Oscillin (65.8 kDa))
ProGP136 (Antigen (60 kDa))
ProGP135 (37-kDa protein)
ProGP134 (Exopolymer)
ProGP133 (Heparinase II)
ProGP132 (Chondroitinase-AC)
ProGP131 (Cell surface phosphatase)
ProGP139 (S-layer glycoprotein)
ProGP140 (α-Glucosidase (thermostable) 160 kDa)
ProGP141 (PGP)
ProGP149 (Crystal toxin (66 kDa))
ProGP148 (β-1,4-mannanase (G-enzyme))
ProGP147 (S-layer glycoprotein (29 kDa, forms tetramer))
ProGP146 (Flagellin)
ProGP145 (Adhesion inhibitor)
ProGP144 (S-layer glycoprotein (120 kDa))
ProGP143 (S-layer glycoprotein (101 kDa))
ProGP142 (Antifreeze protein)
ProGP130 (Pyrolysin)
ProGP86 (Cellulase complex (230 kDa subunit))
ProGP42 (Cellobiosidase)
ProGP30 (Flagellin B1)
ProGP29 (Flagellin A2)
ProGP28 (Flagellin A1)
ProGP27 (Cex (Exoglucanase or xylanase))
ProGP26 (CenA (Endoglucanase A))
ProGP25 (33 and 34 kDa antigens)
ProGP24 (Flagellin FlaB3)
ProGP23 (Flagellin FlaB2)
ProGP31 (Flagellin B2)
ProGP32 (Flagellin B3)
ProGP33 (Streptococcal acid glycoprotein SAGP)
ProGP41 (HPI (hexagonally packed intermediate) layer polypepetide)
ProGP40 (Long-fibril protein (LFP))
ProGP39 (Acidic glycoproteins (133-155 kDa))
ProGP38 (VGP (74 kDa))
ProGP37 (S-layer glycoprotein)
ProGP36 (S-layer glycoprotein)
ProGP35 (β-1,4-Endoglucanases)
ProGP34 (S-layer glycoprotein)
ProGP22 (Flagellin FlaB1)
ProGP21 (Outer membrane protein (75 kDa))
ProGP9 (8 kDa fimbrae)
ProGP8 (Membrane glycoprotein 152 kDa )
ProGP7 (Cellulase CB)
ProGP6 (Cellulase CA)
ProGP5 (Factor PG-1)
ProGP4 (F-pilin)
ProGP3 (S-layer glycoprotein)
ProGP2 (Phytotoxin)
ProGP10 (Flagellin)
ProGP11 (Autolysin (28 kDa))
ProGP12 (12 kDa antigen)
ProGP20 (Outer membrane protein (50 kDa))
ProGP19 (Outer membrane protein (26.5 kDa))
ProGP18 (S-layer glycoprotein SgsE)
ProGP17 (Flagellin)
ProGP16 (50 kDa antigen)
ProGP15 (N-acetylmuramoylhydrolase (Muramidase-2))
ProGP14 (Membrane glycoprotein)
ProGP13 (33 kDa antigen)
ProGP1 (Envelope specific glycoprotein)
ProGP43 (SlgA (cell surface glycoprotein))
ProGP85 (Auracyanin-B2 (18 kDa))
ProGP73 (p115/ PAAP)
ProGP72 (Alkaline Phosphatase D)
ProGP71 (S-layer glycoprotein)
ProGP70 ((1,3-1,4)-beta-glucanase (MAC))
ProGP69 (S-layer glycoprotein)
ProGP68 (S-layer glycoprotein)
ProGP67 (35 kDa flagellin)
ProGP66 (25 kDa flagellin)
ProGP74 (H(A107-M) (1,3-1,4)-beta-glucanase)
ProGP75 (S-layer glycoprotein)
ProGP76 (Cell surface lipoprotein MPB83 (25/23-kDa antigen))
ProGP84 (Auracyanin-B1 (22 kDa))
ProGP83 (Ice nucleation lipoglycoprotein)
ProGP82 (Ice nucleation lipoglycoprotein)
ProGP81 (S-layer glycoprotein)
ProGP80 (S-layer glycoprotein (115 kDa protein))
ProGP79 (S-layer glycoprotein)
ProGP78 (Cell surface glycoprotein (SlgA))
ProGP77 (Major outer membrane protein (MOMP, 40 kD))
ProGP65 (24 kDa flagellin)
ProGP64 (15 kDa-phosphate containing glycoprotein)
ProGP52 (Hypothetical protein)
ProGP51 (Alanine and proline-rich secreted protein Apa (50/55-kDa or 45 kDa MPT 32))
ProGP50 (Flagellin A)
ProGP49 (S-layer glycoprotein)
ProGP48 (S-layer glycoprotein)
ProGP47 (S-layer glycoprotein (92 kDa))
ProGP46 (S-layer glycoprotein (90 kDa))
ProGP45 (S-layer glycoprotein (94 kDa))
ProGP53 (33 kDa minor core flagellin)
ProGP54 (34 kDa major core flagellin)
ProGP55 (Cell surface protein/S-layer protein)
ProGP63 (Xylanase B (Endo-1,4-beta-xylanase B))
ProGP62 (18 kDa and 32 kDa lectin binding proteins
ProGP61 (S-layer glycoprotein (132 kDa))
ProGP60 (S-layer glycoprotein (118 kDa))
ProGP59 (β-1, 4-D-glucosidase (51 kDa))
ProGP58 (Thermopsin)
ProGP57 (38 kDa antigen)
ProGP56 (Cellulolosome complex (Cellulosomal-scaffolding protein A))
ProGP44 (S-layer glycoprotein)
ProGP299 (CcoP)
ProGP287 (PstS3)
ProGP286 (PstS2)
ProGP285 (PpiB)
ProGP284 (PonA2)
ProGP283 (OppA)
ProGP282 (prG)
ProGP281 (LprF)
ProGP280 (LpqW (lipoprotein))
ProGP288 (Rv0020c)
ProGP289 (Rv0281)
ProGP290 (Rv0907)
ProGP298 (FliC (Flagellin subunit))
ProGP297 (FlaB (Flagellin))
ProGP296 (FlaA (Flagellin))
ProGP295 (Thioredoxin)
ProGP294 (Secreted protease)
ProGP293 (Rv2813)
ProGP292 (Rv1084)
ProGP291 (Rv0988)
ProGP279 (LpqT (putative lipoprotein))
ProGP278 (LpqN)
ProGP266 (LprA)
ProGP265 (Rv2799)
ProGP264 (Glycosyl hydrolase)
ProGP263 (Rv3491)
ProGP262 (Pillin (Group IV))
ProGP261 (Flagellin (FlaA))
ProGP260 (FlaB2)
ProGP259 (FlaB1)
ProGP267 (GgtB)
ProGP268 (BfrB)
ProGP269 (Bglu)
ProGP277 (LpqI)
ProGP276 (LpqF lipoprotein)
ProGP275 (LpqB lipoprotein)
ProGP274 (LppZ (Putative lipoprotein))
ProGP273 (LppX (Putative lipoprotein))
ProGP272 (LppL)
ProGP271 (FecB)
ProGP270 (BlaC)
ProGP258 (FlaB3)
ProGP300 (CycB)
ProGP342 (FTH_0357)
ProGP330 (FTH_0159)
ProGP329 (FTH_1830)
ProGP328 (Extracellular matrix protein adhesin A (EmaA))
ProGP327 (LccA, an Archaeal Laccase)
ProGP326 (FliC (Flagellin))
ProGP325 (FliC (Flagellin))
ProGP324 (FliC (Flagellin))
ProGP323 (JlpA (42-45 kDa antigen))
ProGP331 (FTH_1855)
ProGP332 (FTH_0539)
ProGP333 (FTH_1112)
ProGP341 (FTH_0414)
ProGP340 (FTH_1071)
ProGP339 (FTH_0069)
ProGP338 (FTH_1293)
ProGP337 (FTH_1721)
ProGP336 (FTH_1761)
ProGP335 (FTH_1167)
ProGP334 (FTH_0311)
ProGP322 (EtpA Adhesin)
ProGP321 (OmpA)
ProGP309 (PstS (40 kDa))
ProGP308 (Sco)
ProGP307 (PotF)
ProGP306 (Mip (Peptidyl-prolyl cis-trans isomerase
ProGP305 (Laz)
ProGP304 (Gna1946)
ProGP303 (DsbA)
ProGP302 (AniA)
ProGP310 (Hypothetical protein)
ProGP311 (BF2494)
ProGP312 (Hypothetical protein)
ProGP320 (LppC)
ProGP319 (BF0935)
ProGP318 (BF3918)
ProGP317 (BF3567)
ProGP316 (Srr1)
ProGP315 (Putative outer membrane protein)
ProGP314 (Putative exported protein)
ProGP313 (Hypothetical protein)
ProGP301 (S-layer Protein)
ProGP257 (Microcystin-related protein C (MrpC))
ProGP213 (95-kDa glycoprotein)
ProGP201 (Diffuse Adherence Adhesin (AIDA-I))
ProGP200 (Laminin-binding glycoprotein (MS-LBP) or histone-like protein)
ProGP199 (Flagellin)
ProGP198 (Flagellin)
ProGP197 (Subtilisin (SBL)-Cys mutant)
ProGP196 (ComP)
ProGP195 (Streptococcal acid glycoprotein SAGP)
ProGP194 (PS4A (water soluble protein-polysaccharide))
ProGP202 (TMBP (Trehalose/maltose binding protein)
ProGP203 (Cell envelope glycoprotein)
ProGP204 (CbtA (Cellobiose binding protein)
ProGP212 (MDBP (Maltodextrin binding protein))
ProGP211 (TMBP (Trehalose/maltose binding protein)
ProGP210 (Protein-serine/threonine kinase (SsoPK1)
ProGP209 (Fap1 (Fimbrial adhesin))
ProGP208 (SbsD (S-layer glycoprotein))
ProGP207 (Glycopeptidolipid (GPL))
ProGP206 (Flagellin (FlaA))
ProGP205 (Flagellin A (FlaA))
ProGP193 (PstS1)
ProGP192 (LpqH)
ProGP180 (S-layer glycoprotein (27 kDa))
ProGP179 (S-layer glycoprotein)
ProGP178 (mtRgpA)
ProGP177 (HRgpA)
ProGP176 (TibA (outer membrane protein synthesized as preTibA))
ProGP175 (Flagellin B)
ProGP174 (Flagellin A)
ProGP173 (GBP (Glucose binding protein)/GlcS)
ProGP181 (P140 (140 kDa protein))
ProGP182 (P120 (120 kDa protein))
ProGP183 (GlnH)
ProGP191 (LppQ lipoprotein)
ProGP190 (LppN lipoprotein)
ProGP189 (Superoxide dismutase [Cu-Zn])
ProGP188 (flaB)
ProGP187 (flaA)
ProGP186 (98-kDa ,58-kDa, 54-kDa glycoproteins)
ProGP185 (Invertase)
ProGP184 (Mpt83 (Cell surface lipoprotein))
ProGP172 (S-layer glycoprotein)
ProGP214 (Flagellin B)
ProGP256 (CmeC)
ProGP244 (SrpA)
ProGP243 (Synthetic Glycopeptide)
ProGP242 (S-layer protein)
ProGP241 (FlaA)
ProGP240 (FlaB3)
ProGP239 (FlaB2)
ProGP238 (FlaB1)
ProGP237 (SgtA)
ProGP245 (SraP (serine-rich adhesin for platelets)
ProGP246 (BclB (collagen-like protein))
ProGP247 (Flagellin A)
ProGP255 (HmcA)
ProGP254 (Dps (18 kDa), Stress inducible DNA binding protein)
ProGP253 (DgpC)
ProGP252 (DgpA)
ProGP251 (Type b Flagellin)
ProGP250 (PilA (Pilin))
ProGP249 (Ag43α (Antigen 43 passenger domain))
ProGP248 (Flagellin B)
ProGP236 (HisJ)
ProGP235 (CipB (putative dipeptide-binding protein
ProGP223 (ZnuA)
ProGP222 (PEB3)
ProGP221 (Cj1496c)
ProGP220 (Cj0200c)
ProGP219 (Cj0114)
ProGP218 (CgpA)
ProGP217 (AcrA or CmeA)
ProGP216 (BclA (collagen-like protein))
ProGP224 (Flagellin)
ProGP225 (Flagellin)
ProGP226 (Flagellin)
ProGP234 (CipA (conserved hypothetical protein))
ProGP233 (Resuscitation promoting factor 2 (Rpf2))
ProGP232 (Flagellin FlaA)
ProGP231 (VirB10 protein)
ProGP230 (PilA (Type IV pilin))
ProGP229 (GspB)
ProGP228 (Short glycopeptides)
ProGP227 (HMW1 (Adhesin))
ProGP215 (Flagellin A (FlaA))
Search Display Criteria
all
Organism
Gene Information
Genome Information
Protein Information
Protein Structure
Glycosylation Status
Glycan Information
Protein Glycosylation linked (PGL) gene(s)
Accessory PGL Gene(s)
Literature
ProGP ID
ProGP429 (Maltose ABC transporter)
Validation Status
Characterized
Organism Information
Organism Name
Sulfolobus solfataricus P2 (DSM 1617)
Domain
Archaea
Classification
Family: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI)
273057
Genome Information
GenBank
AE006641
EMBL
AE006641.1
Gene Information
Gene Name
SSO1171
NCBI Gene ID
27427475
GenBank Gene Sequence
NZ_LT549890.1
Protein Information
Protein Name
Maltose ABC transporter
UniProtKB/SwissProt ID
Q97YY1
NCBI RefSeq
WP_010923220.1
EMBL-CDS
AAK41419.1
UniProtKB Sequence
>tr|Q97YY1|Q97YY1_SULSO Maltose ABC transporter OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO1171 PE=4 SV=1 MGRKGKKIDYKAISKTLVAVIIVVVIVIAIGGVYAFLSSQHSPAAPSSTTTSFTSTTSST TTSSVLNTSNPQALMQLVGISTPPSTPVTITVWNSYSTSENQAFNETLAQFEQAFPWIHV QVTYGVGVGTSQFETAAKAGQAPIVYRDTSDSGGALFAAGLVLNLSQYLPQSITSLYVPT AIKDWELNGSLYGLPDNVNYIVMFYNKKFVPYPPNTTEQLVQIAESVNKTYHVWGIAYGA GDEYGYRFAAWFAGFGGQIFTTNNGKIVPALNSTAMVNALNFWYNLTYNLKVNYLAPSTG AGGAEGQLFVANQTAIIFDGPWDLNAYLQALGPNLGAAPLPVVSQTGLRAAPFIGSTGFL VSSPQASGATPLQIKAALLFVLYFTNYQADLRLWEVAHDIPANLQAYNEALTQLKEGMLQ PTYLNQIMEGILEQAQYGQQFPNIPQMAYYWNSFHQYASEFFANKVNATQASQGMEQAFI QALVQNGLMSSLSPLPIIPQYMLLLISVILTPMVVVITPRKRW
Sequence length
523 AA
Subcellular Location
Membrane
Function
Maltose ABC transporter
Glycosylation Status
Glycosylation Type
N- (Asn) linked
Experimentally Validated Glycosite(s) in Full Length Protein
N215 and N228
Glycosite(s) Annotated Protein Sequence
>tr|Q97YY1|Q97YY1_SULSO Maltose ABC transporter OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO1171 PE=4 SV=1 MGRKGKKIDYKAISKTLVAVIIVVVIVIAIGGVYAFLSSQHSPAAPSSTTTSFTSTTSST TTSSVLNTSNPQALMQLVGISTPPSTPVTITVWNSYSTSENQAFNETLAQFEQAFPWIHV QVTYGVGVGTSQFETAAKAGQAPIVYRDTSDSGGALFAAGLVLNLSQYLPQSITSLYVPT AIKDWELNGSLYGLPDNVNYIVMFYNKKFVPYPP
N*(215)
TTEQLVQIAESV
N*(228)
KTYHVWGIAYGA GDEYGYRFAAWFAGFGGQIFTTNNGKIVPALNSTAMVNALNFWYNLTYNLKVNYLAPSTG AGGAEGQLFVANQTAIIFDGPWDLNAYLQALGPNLGAAPLPVVSQTGLRAAPFIGSTGFL VSSPQASGATPLQIKAALLFVLYFTNYQADLRLWEVAHDIPANLQAYNEALTQLKEGMLQ PTYLNQIMEGILEQAQYGQQFPNIPQMAYYWNSFHQYASEFFANKVNATQASQGMEQAFI QALVQNGLMSSLSPLPIIPQYMLLLISVILTPMVVVITPRKRW
Sequence Around Glycosites (21 AA)
YNKKFVPYPPNTTEQLVQIAE
EQLVQIAESVNKTYHVWGIAY
ProGP Web Logo
Technique(s) used for Glycosylation Detection
Concanavalin A lectin affinity chromatography
Glycan Information
Glycan Annotation
Branched sulfated heptasaccharide, Hex4(GlcNAc)2 plus sulfoquinovose where Hex is D-mannose and D-glucose.
Literature
Year of Identification
2013
Year of Identification Month Wise
2013.6.1
Year of Validation
2013
Reference
Gianna Palmieri, Marco Balestrieri, Jasna Peter-Katalinić, Gottfried Pohlentz, Mosè Rossi, Immacolata Fiume, and Gabriella Pocsfalvi (2013) Surface-exposed glycoproteins of hyperthermophilic Sulfolobus solfataricus P2 show a common N-glycosylation profile. J. Proteome Res., 12, 2779−2790.
Corresponding Author
Gabriella Pocsfalvi
Contact
Institute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.
Reference
Schulz BL, Jen FE, Power PM, Jones CE, Fox KL, Ku SC, Blanchfield JT, Jennings MP. (2013) Identification of bacterial protein O-oligosaccharyltransferases and their glycoprotein substrates. PLoS One, 8(5):e62768. [PubMed: 23658772]
Author
Gianna Palmieri, Marco Balestrieri, Jasna Peter-Katalinic?, Gottfried Pohlentz, Mose? Rossi, Immacolata Fiume, and Gabriella Pocsfalvi
Research Group
Institute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.
Corresponding Author
Gabriella Pocsfalvi
Contact
Institute of Protein Biochemistry, National Research Council of Italy, Napoli, Italy.
ProCGP (Characterized Glycoproteins)
is a compilation of bacterial and archaeal glycoproteins for which at least one site of glycosylation is validated experimentally using one or multiple methods like, site directed mutagenesis, Edman degradation, mass spectroscopy etc. Each entry in ProCGP has a unique identifier ProGP ID. ProCGP search allows user to seek experimentally verified information about an entry selected by using four different search criteria.
ProUGP (Uncharacterized Glycoproteins)
is a compilation of bacterial and archaeal glycoproteins that are known to be glycosylated from experiments like PAS staining, abberant migration on SDS-PAGE, lectin binding etc. but yet not mapped for the precise position of glycosylated residue (s) in a protein sequence. Each entry in ProUGP has a unique identifier ProGP ID. ProUGP search provides manually curated, published information about selected entry in ProUGP.
Choose Search Criteria
Choose
ProGP ID
Organism
Protein Name
UniProtKB/SwissProt ID
Select Value
Select Value
Choose Display Criteria
All
Organism
Gene Information
Genome Information
Protein Information
Glycosylation Status
Glycan Information
Protein Glycosylation linked (PGL) gene(s)
Accessory PGL Gene(s)
Literature
ProGT_Main (Prokaryotic Protein Glycosyl Transferases):
is a compilation of bacterial and archaeal protein glycosyltransferases for which at least one genetic or biochemical evidence of glycosyltransferase activity is validated in the published literature. Each entry in ProGT_Main has a unique identifier ProGT ID. ProGT_Main search allows user to seek experimentally verified information about an entry selected by using four different search criteria
ProGT_Accessory (Accessory Protein or enzyme to Prokaryotic Protein Glycosyl Transferases):
is a compilation of such bacterial and archaeal proteins/enzyme that have miscellaneous accessory roles in a given protein glycosylation pathway of a characterized protein glycosyltransferases compiled in ProGT_Main. The qualifying criteria is at least one known genetic or biochemical evidence of accessory function, in literature. Each entry in ProGT_Accessory has a unique identifier ProGT ID. ProGT_Accessory search provides manually curated, published information about selected entry.
Choose Search Criteria
Choose
ProGT ID
Organism
Protein Name
UniProtKB/SwissProt ID
Select Value
Search Display Criteria
All
Organism
Gene Information
Genome Information
Protein Name
Glycan Information
Acceptor Subtrate Information
Literature
Search Location
choose Database
Choose
Main
Accessory
ProCGP
ProUGP
Enter ID.
#ex1