ProGP43 (SlgA (cell surface glycoprotein))
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP43 (SlgA (cell surface glycoprotein)) |
Validation Status | Characterized |
Organism Information | |
Organism Name | Methanothermus fervidus strain V24S (DSM 2088) |
Domain | Archaea |
Classification | Family: Methanothermaceae Order: Methanobacteriales Class: Methanobacteria or Archaeobacteria Division or phylum: "Euryarchaeota" |
Taxonomic ID (NCBI) | 2180 |
Genome Information | |
GenBank | X58297 |
EMBL | X58297 |
Gene Information | |
Gene Name | slgA |
Protein Information | |
Protein Name | SlgA (cell surface glycoprotein) |
UniProtKB/SwissProt ID | P27373 |
EMBL-CDS | CAA41230.1 |
UniProtKB Sequence | >sp|P27373|CSG_METFE Cell surface glycoprotein OS=Methanothermus fervidus GN=slgA PE=1 SV=1 MRKFTLLMLLLIVISMSGIAGAAEVKNLNTSKTFTKIQEAIDDPSTTDGNIIIVGPGNYT ENILVNKSLTLKSNGSAIINAVSSEKSTITIKANNVWIEGFIIIGGKNGIYMENVTGCTI TNNTIQNAFVSGWEYYGGNGICLVNSTNNTITNNIIRNNTWNGINVCESKGNIIKNNTIM YSGGIGIYVWGFNKFEGNNIIENNRIINATYGGIYLFRPSNNKICRNYIANVSSGGGGMS GAICIDVSDYNIVKDNIGINCDGGLFTDGMIGNEITNNIFKNCKVAVSESTYGPASRNNK IYGNYFINYETAISDPKGELVDNIWNTTEGGNYWSNYTGNNTGDGTGNIPYYYDNKPLVV DLAIEDIAAKPSGIEVRVKNLGKADIKKIDPLTKLKIKISCDNDVYETFIDPLSAGESQI VRWDKIVPEGNHTIKAEIPYSAEGYLIGTNIRDADISNNVFSKIVQGFVQNKTFTITLTN LGKSTITIKYYISIYTNPVNGTKVSYRELTITLKPNETKTIELGKYPFKYAVSGTMIVKN PSRYRIPLNLRIKYEIEGLNPQMREISKYIAPRGEFRYIARYTGKEEGYADVW |
Sequence length | 593 AA |
Subcellular Location | Surface |
Function | In Archaea, which do not possess other cell wall components, the S-layer has to maintain the cell integrity and stabilize as well as to protect the cell against mechanical and osmotic stresses or extreme pH conditions. It is also predicted that the S-layer has to maintain or even determine the cell shape. |
Glycosylation Status | |
Glycosylation Type | N- (Asn) linked |
Experimentally Validated Glycosite(s) in Full Length Protein | (Signal peptide: 1-22) N29 in case of precursor protein. |
Experimentally Validated Glycosite(s ) in Mature Protein | N7 |
Glycosite(s) Annotated Protein Sequence | >sp|P27373|CSG_METFE Cell surface glycoprotein OS=Methanothermus fervidus GN=slgA PE=1 SV=1 MRKFTLLMLLLIVISMSGIAGAAEVKNLN*(29)TSKTFTKIQEAIDDPSTTDGNIIIVGPGNYT ENILVNKSLTLKSNGSAIINAVSSEKSTITIKANNVWIEGFIIIGGKNGIYMENVTGCTI TNNTIQNAFVSGWEYYGGNGICLVNSTNNTITNNIIRNNTWNGINVCESKGNIIKNNTIM YSGGIGIYVWGFNKFEGNNIIENNRIINATYGGIYLFRPSNNKICRNYIANVSSGGGGMS GAICIDVSDYNIVKDNIGINCDGGLFTDGMIGNEITNNIFKNCKVAVSESTYGPASRNNK IYGNYFINYETAISDPKGELVDNIWNTTEGGNYWSNYTGNNTGDGTGNIPYYYDNKPLVV DLAIEDIAAKPSGIEVRVKNLGKADIKKIDPLTKLKIKISCDNDVYETFIDPLSAGESQI VRWDKIVPEGNHTIKAEIPYSAEGYLIGTNIRDADISNNVFSKIVQGFVQNKTFTITLTN LGKSTITIKYYISIYTNPVNGTKVSYRELTITLKPNETKTIELGKYPFKYAVSGTMIVKN PSRYRIPLNLRIKYEIEGLNPQMREISKYIAPRGEFRYIARYTGKEEGYADVW |
Sequence Around Glycosites (21 AA) | IAGAAEVKNLNTSKTFTKIQE |
Technique(s) used for Glycosylation Detection | Carbohydrate detection (TLC, thin layer chromatography) |
Technique(s) used for Glycosylated Residue(s) Detection | Edman degradation |
Glycan Information | |
Glycan Annotation | Linkage: β-GlcNAc-Asn. N-linked heterosaccharide is 17 % of molecular weight of the protein. Composition of the hexasaccharide (1061.83 Da) is α-D-3-O-MetManp-(1→6)-α-D-3-O-MetManp-[(1→2)-α-D-Manp]3-(1→4)-D-GalNAc. 3-O-methylglucose, N-acetylglucosamine, and galactose are also found in lesser amounts. 3-O-methylmannose could be partly replaced by 3-O-methylglucose. 3-O-methylmannose and 3-O-methylglucose are present in the intact glycoprotein in a molar ratio of 7:1. |
BCSDB ID | 136864 |
GlyTouCan | G20415AH |
Technique(s) used for Glycan Identification | Methylation analysis, plasma desorption mass spectrometry, and high field 1H, 13C NMR spectroscopy- COSY (correlated spectroscopy), 1D-, 2D-TOCSY (total correlation spectroscopy), and HMBC (heteronuclear multiple bond coherence), HMQC (heteronuclear multiple quantum correlation). |
Protein Glycosylation linked (PGL) gene(s) | |
OST Gene Name | Oligosaccharyl transferase stt3 subunit |
Literature | |
Year of Identification | 1989 |
Year of Identification Month Wise | 1989.02.05 |
Year of Validation | 1991 |
Reference | Kärcher, U., Schröder, H., Haslinger, E., Allmaier, G., Schreiner, R., Wieland, F., Haselbeck, A. and König, H., 1993. Primary structure of the heterosaccharide of the surface glycoprotein of Methanothermus fervidus. Journal of Biological Chemistry, 268(36), pp.26821-26826. |
Corresponding Author | Helmut König |
Contact | Applied Microbiology and Mycology Department, Ulm University, Germany. |
Reference | Kalmokoff, M.L., Koval, S.F. and Jarrell, K.F., 1992. Relatedness of the flagellins from methanogens. Archives of microbiology, 157(6), pp.481-487. |
Corresponding Author | KEN F. JARRELL |
Contact | Department of Microbiology and Immunology, Queen's University, Kingston, Ontario, Canada. |
Reference | BRÖCKL, G., BEHR, M., FABRY, S., HENSEL, R., KAUDEWITZ, H., BIENDL, E. and KÖNIG, H., 1991. Analysis and nucleotide sequence of the genes encoding the surface‐layer glycoproteins of the hyperthermophilic methanogens Methanothermus fervidus and Methanothermus sociabilis. European journal of biochemistry, 199(1), pp.147-152. |
Corresponding Author | Helmut König |
Contact | Department of Applied Microbiology, University of Ulm, Federal Republic of Germany |
Reference | Hartmann, E. and König, H., 1989. Uridine and dolichyl diphosphate activated oligosaccharides are intermediates in the biosynthesis of the S-layer glycoprotein of Methanothermus fervidus. Archives of microbiology, 151(3), pp.274-281. |
Corresponding Author | Helmut König |
Contact | Applied Microbiology and Mycology Department, Ulm University, Germany. |
Reference | Karcher, U., Schroder, H., Haslinger, E., Allmaier, G., Schreiner, R., Wieland, F., Haselbeck, A. and Konig, H. (1993) Primary structure of the heterosaccharide of the surface glycoprotein of Methanothermus fervidus. J Biol Chem, 268, 26821-26826. [PubMed: 8262914] |
Author | Karcher, U., Schroder, H., Haslinger, E., Allmaier, G., Schreiner, R., Wieland, F., Haselbeck, A. and Konig, H. |
Research Group | Department of Applied Microbiology and Mycology, University of Ulm, Germany. |
Corresponding Author | Konig, H. |
Contact | Department of Applied Microbiology and Mycology, University of Ulm, Germany. |
Reference | Kalmokoff, M.L., Koval, S.F. and Jarrell, K.F. (1992) Relatedness of the flagellins from methanogens. Arch Microbiol, 157, 481-487. [PubMed: 1503530] |
Author | Kalmokoff, M.L., Koval, S.F. and Jarrell, K.F. |
Research Group | Department of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada. |
Corresponding Author | Jarrell, K.F. |
Contact | Department of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada. |
Reference | Kalmokoff, M.L., Koval, S.F. and Jarrell, K.F. (1992) Relatedness of the flagellins from methanogens. Arch Microbiol, 157, 481-487. [PubMed: 1503530] |
Author | Kalmokoff, M.L., Koval, S.F. Jarrell, K.F. |
Research Group | Department of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada. |
Corresponding Author | Jarrell, K.F. |
Contact | Department of Microbiology and Immunology, Queens University, Kingston, Ontario, Canada. |
Reference | Brockl, G., Behr, M., Fabry, S., Hensel, R., Kaudewitz, H., Biendl, E. and Konig, H. (1991) Analysis and nucleotide sequence of the genes encoding the surface-layer glycoproteins of the hyperthermophilic methanogens Methanothermus fervidus and Methanothermus sociabilis. Eur J Biochem, 199, 147-152. [PubMed: 1712296] |
Author | Brockl, G., Behr, M., Fabry, S., Hensel, R., Kaudewitz, H., Biendl, E. Konig, H. |
Research Group | Department of Applied Microbiology, University of Ulm, Federal Republic of Germany |
Corresponding Author | Konig, H. |
Contact | Department of Applied Microbiology, University of Ulm, Federal Republic of Germany |
Reference | Hartmann, E. and König, H. (1989) Uridine and dolichyl diphosphate activated oligosaccharides are intermediates in the biosynthesis of the S-layer glycoprotein of Methanothermus fervidus. Arch Microbiol, 151, 274-281. |
Author | Hartmann, E. König, H. |
Research Group | Applied Microbiology Ulm University Ulm Federal Republic of Germany |
Corresponding Author | König, H. |
Contact | Applied Microbiology Ulm University Ulm Federal Republic of Germany |