Home
ProGPdb
Search
Example Display Page
ProGTdb
Search
Example Display Page
Search By Features
Organism
Gene
Donor
Protein
Glycan
Mechanism
Year
Structure Gallery
Crystal Structure
ProGP
ProGT
ProGT Accessory
Homology Model
ProGP
ProGT
Links
Related Reviews
Related Tools & Databases
Bibliography ProGlycProt
GlycoPP V2.0 (beta launch)
Contact Us
Update (2022 release) in progress
ProGP436 (Acm2)
Home
-> ProGPdb ->
Search ProGP
-> Display data
Compare ID
ProGP436 (Acm2)
ProGP1 (Envelope specific glycoprotein)
ProGP2 (Phytotoxin)
ProGP3 (S-layer glycoprotein)
ProGP4 (F-pilin)
ProGP5 (Factor PG-1)
ProGP6 (Cellulase CA)
ProGP7 (Cellulase CB)
ProGP8 (Membrane glycoprotein 152 kDa )
ProGP9 (8 kDa fimbrae)
ProGP10 (Flagellin)
ProGP11 (Autolysin (28 kDa))
ProGP12 (12 kDa antigen)
ProGP13 (33 kDa antigen)
ProGP14 (Membrane glycoprotein)
ProGP15 (N-acetylmuramoylhydrolase (Muramidase-2))
ProGP16 (50 kDa antigen)
ProGP17 (Flagellin)
ProGP18 (S-layer glycoprotein SgsE)
ProGP19 (Outer membrane protein (26.5 kDa))
ProGP20 (Outer membrane protein (50 kDa))
ProGP21 (Outer membrane protein (75 kDa))
ProGP22 (Flagellin FlaB1)
ProGP23 (Flagellin FlaB2)
ProGP24 (Flagellin FlaB3)
ProGP25 (33 and 34 kDa antigens)
ProGP26 (CenA (Endoglucanase A))
ProGP27 (Cex (Exoglucanase or xylanase))
ProGP28 (Flagellin A1)
ProGP29 (Flagellin A2)
ProGP30 (Flagellin B1)
ProGP31 (Flagellin B2)
ProGP32 (Flagellin B3)
ProGP33 (Streptococcal acid glycoprotein SAGP)
ProGP34 (S-layer glycoprotein)
ProGP35 (?-1,4-Endoglucanases)
ProGP36 (S-layer glycoprotein)
ProGP37 (S-layer glycoprotein)
ProGP38 (VGP (74 kDa))
ProGP39 (Acidic glycoproteins (133-155 kDa))
ProGP40 (Long-fibril protein (LFP))
ProGP41 (HPI (hexagonally packed intermediate) layer polypepetide)
ProGP42 (Cellobiosidase)
ProGP43 (SlgA (cell surface glycoprotein))
ProGP44 (S-layer glycoprotein)
ProGP45 (S-layer glycoprotein (94 kDa))
ProGP46 (S-layer glycoprotein (90 kDa))
ProGP47 (S-layer glycoprotein (92 kDa))
ProGP48 (S-layer glycoprotein)
ProGP49 (S-layer glycoprotein)
ProGP50 (Flagellin A)
ProGP51 (Alanine and proline-rich secreted protein Apa (50/55-kDa or 45 kDa MPT 32))
ProGP52 (Hypothetical protein)
ProGP53 (33 kDa minor core flagellin)
ProGP54 (34 kDa major core flagellin)
ProGP55 (Cell surface protein/S-layer protein)
ProGP56 (Cellulolosome complex (Cellulosomal-scaffolding protein A))
ProGP57 (38 kDa antigen)
ProGP58 (Thermopsin)
ProGP59 (?-1, 4-D-glucosidase (51 kDa))
ProGP60 (S-layer glycoprotein (118 kDa))
ProGP61 (S-layer glycoprotein (132 kDa))
ProGP62 (18 kDa and 32 kDa lectin binding proteins
ProGP63 (Xylanase B (Endo-1,4-beta-xylanase B))
ProGP64 (15 kDa-phosphate containing glycoprotein)
ProGP65 (24 kDa flagellin)
ProGP66 (25 kDa flagellin)
ProGP67 (35 kDa flagellin)
ProGP68 (S-layer glycoprotein)
ProGP69 (S-layer glycoprotein)
ProGP70 ((1,3-1,4)-beta-glucanase (MAC))
ProGP71 (S-layer glycoprotein)
ProGP72 (Alkaline Phosphatase D)
ProGP73 (p115/ PAAP)
ProGP74 (H(A107-M) (1,3-1,4)-beta-glucanase)
ProGP75 (S-layer glycoprotein)
ProGP76 (Cell surface lipoprotein MPB83 (25/23-kDa antigen))
ProGP77 (Major outer membrane protein (MOMP, 40 kD))
ProGP78 (Cell surface glycoprotein (SlgA))
ProGP79 (S-layer glycoprotein)
ProGP80 (S-layer glycoprotein (115 kDa protein))
ProGP81 (S-layer glycoprotein)
ProGP82 (Ice nucleation lipoglycoprotein)
ProGP83 (Ice nucleation lipoglycoprotein)
ProGP84 (Auracyanin-B1 (22 kDa))
ProGP85 (Auracyanin-B2 (18 kDa))
ProGP86 (Cellulase complex (230 kDa subunit))
ProGP87 (Cellulase (30 kDa) and Xylanase (15.7 kDa))
ProGP88 (S-layer glycoprotein)
ProGP89 (Surface layer glycoprotein)
ProGP90 (Antigens)
ProGP91 (S-layer glycoprotein (82 kDa))
ProGP92 (Anitigen (1000 kDa protein))
ProGP93 (Protein complex)
ProGP94 (Surface layer glycoprotein)
ProGP95 (S-layer glycoprotein)
ProGP96 (PS2 (S-layer glycoprotein))
ProGP97 (27kDa flagellin)
ProGP98 (32kDa flagellin)
ProGP99 (PilE (pilin))
ProGP100 (PF sheath protein (44 kDa))
ProGP101 (H(A16-M) (1,3-1,4)-beta-glucanase)
ProGP102 (Flagellin B1)
ProGP103 (Flagellin B2)
ProGP104 (S-layer glycoprotein (138 kDa))
ProGP105 (S-layer glycoprotein)
ProGP106 (Heparin lyase I or Heparinase I)
ProGP107 (Fimbrial protein (pilin); (group I T4P))
ProGP108 (Tetrabrachion (S layer glycoprotein))
ProGP109 (Stable protease)
ProGP110 (45 to 47-kDa protein)
ProGP111 (S-layer glycoprotein)
ProGP112 (72-kDa glycoprotein (ExsJ))
ProGP113 (Flagellin Laf1)
ProGP114 (Endo-?-N-acetylglucosaminidase F2)
ProGP115 (Flavastacin (P40))
ProGP116 (Endo-?-N-acetylglucosaminidase F3)
ProGP117 (Cell surface glycoprotein (S-layer protein))
ProGP118 (Flagellin)
ProGP119 (Fimbrial protein (pilin))
ProGP120 (Protein A (cell wall glycoprotein))
ProGP121 (Surface layer glycoprotein Sat B)
ProGP122 (Surface layer glycoprotein SatA)
ProGP123 (CRX (Copper response extracellular protein))
ProGP124 (?-1,4-mannanase)
ProGP125 (Flagellin)
ProGP126 (31/33 kDa flagellin)
ProGP127 (Flagellin B1 (41 kDa))
ProGP128 (wmA (S-layer protein))
ProGP129 (RU 41740-P1 Glyoprotein fraction (non endotoxin))
ProGP130 (Pyrolysin)
ProGP131 (Cell surface phosphatase)
ProGP132 (Chondroitinase-AC)
ProGP133 (Heparinase II)
ProGP134 (Exopolymer)
ProGP135 (37-kDa protein)
ProGP136 (Antigen (60 kDa))
ProGP137 (Oscillin (65.8 kDa))
ProGP138 (Cell surface glycoprotein)
ProGP139 (S-layer glycoprotein)
ProGP140 (?-Glucosidase (thermostable) 160 kDa)
ProGP141 (PGP)
ProGP142 (Antifreeze protein)
ProGP143 (S-layer glycoprotein (101 kDa))
ProGP144 (S-layer glycoprotein (120 kDa))
ProGP145 (Adhesion inhibitor)
ProGP146 (Flagellin)
ProGP147 (S-layer glycoprotein (29 kDa, forms tetramer))
ProGP148 (?-1,4-mannanase (G-enzyme))
ProGP149 (Crystal toxin (66 kDa))
ProGP150 (Cytochrome b558/566 subunit A (b type hemoprotein))
ProGP151 (P 110 (Adhesin-like glycoprotein 110 kDa))
ProGP152 (Type A Flagellin)
ProGP153 (Flagellin)
ProGP154 (Flagellin)
ProGP155 (Flagellin)
ProGP156 (AnAF)
ProGP157 (HBHA (heparin-binding hemagglutinin))
ProGP158 (FlaB (flagellar core protein))
ProGP159 (FlaB (flagellar core protein))
ProGP160 (Flagellar filament 31.3 kDa core protein
ProGP161 (FlaB (flagellar core protein))
ProGP162 (FlaB (flagellar core protein))
ProGP163 (FlaB (flagellar core protein))
ProGP164 (FlaB (flagellar core protein))
ProGP165 (S-layer glycopeptide)
ProGP166 (Chondroitinase-B)
ProGP167 (BclA (collagen-like protein))
ProGP168 (Slp (S-layer glycoprotein))
ProGP169 (Surface layer glycoproteins)
ProGP170 (Cysteine proteases (extracellular) Arg-gingipains (RgpA))
ProGP171 (Man26A (b-mannosidase 26A))
ProGP172 (S-layer glycoprotein)
ProGP173 (GBP (Glucose binding protein)/GlcS)
ProGP174 (Flagellin A)
ProGP175 (Flagellin B)
ProGP176 (TibA (outer membrane protein synthesized as preTibA))
ProGP177 (HRgpA)
ProGP178 (mtRgpA)
ProGP179 (S-layer glycoprotein)
ProGP180 (S-layer glycoprotein (27 kDa))
ProGP181 (P140 (140 kDa protein))
ProGP182 (P120 (120 kDa protein))
ProGP183 (GlnH)
ProGP184 (Mpt83 (Cell surface lipoprotein))
ProGP185 (Invertase)
ProGP186 (98-kDa ,58-kDa, 54-kDa glycoproteins)
ProGP187 (flaA)
ProGP188 (flaB)
ProGP189 (Superoxide dismutase [Cu-Zn])
ProGP190 (LppN lipoprotein)
ProGP191 (LppQ lipoprotein)
ProGP192 (LpqH)
ProGP193 (PstS1)
ProGP194 (PS4A (water soluble protein-polysaccharide))
ProGP195 (Streptococcal acid glycoprotein SAGP)
ProGP196 (ComP)
ProGP197 (Subtilisin (SBL)-Cys mutant)
ProGP198 (Flagellin)
ProGP199 (Flagellin)
ProGP200 (Laminin-binding glycoprotein (MS-LBP) or histone-like protein)
ProGP201 (Diffuse Adherence Adhesin (AIDA-I))
ProGP202 (TMBP (Trehalose/maltose binding protein)
ProGP203 (Cell envelope glycoprotein)
ProGP204 (CbtA (Cellobiose binding protein)
ProGP205 (Flagellin A (FlaA))
ProGP206 (Flagellin (FlaA))
ProGP207 (Glycopeptidolipid (GPL))
ProGP208 (SbsD (S-layer glycoprotein))
ProGP209 (Fap1 (Fimbrial adhesin))
ProGP210 (Protein-serine/threonine kinase (SsoPK1)
ProGP211 (TMBP (Trehalose/maltose binding protein)
ProGP212 (MDBP (Maltodextrin binding protein))
ProGP213 (95-kDa glycoprotein)
ProGP214 (Flagellin B)
ProGP215 (Flagellin A (FlaA))
ProGP216 (BclA (collagen-like protein))
ProGP217 (AcrA or CmeA)
ProGP218 (CgpA)
ProGP219 (Cj0114)
ProGP220 (Cj0200c)
ProGP221 (Cj1496c)
ProGP222 (PEB3)
ProGP223 (ZnuA)
ProGP224 (Flagellin)
ProGP225 (Flagellin)
ProGP226 (Flagellin)
ProGP227 (HMW1 (Adhesin))
ProGP228 (Short glycopeptides)
ProGP229 (GspB)
ProGP230 (PilA (Type IV pilin))
ProGP231 (VirB10 protein)
ProGP232 (Flagellin FlaA)
ProGP233 (Resuscitation promoting factor 2 (Rpf2))
ProGP234 (CipA (conserved hypothetical protein))
ProGP235 (CipB (putative dipeptide-binding protein
ProGP236 (HisJ)
ProGP237 (SgtA)
ProGP238 (FlaB1)
ProGP239 (FlaB2)
ProGP240 (FlaB3)
ProGP241 (FlaA)
ProGP242 (S-layer protein)
ProGP243 (Synthetic Glycopeptide)
ProGP244 (SrpA)
ProGP245 (SraP (serine-rich adhesin for platelets)
ProGP246 (BclB (collagen-like protein))
ProGP247 (Flagellin A)
ProGP248 (Flagellin B)
ProGP249 (Ag43? (Antigen 43 passenger domain))
ProGP250 (PilA (Pilin))
ProGP251 (Type b Flagellin)
ProGP252 (DgpA)
ProGP253 (DgpC)
ProGP254 (Dps (18 kDa), Stress inducible DNA binding protein)
ProGP255 (HmcA)
ProGP256 (CmeC)
ProGP257 (Microcystin-related protein C (MrpC))
ProGP258 (FlaB3)
ProGP259 (FlaB1)
ProGP260 (FlaB2)
ProGP261 (Flagellin (FlaA))
ProGP262 (Pillin (Group IV))
ProGP263 (Rv3491)
ProGP264 (Glycosyl hydrolase)
ProGP265 (Rv2799)
ProGP266 (LprA)
ProGP267 (GgtB)
ProGP268 (BfrB)
ProGP269 (Bglu)
ProGP270 (BlaC)
ProGP271 (FecB)
ProGP272 (LppL)
ProGP273 (LppX (Putative lipoprotein))
ProGP274 (LppZ (Putative lipoprotein))
ProGP275 (LpqB lipoprotein)
ProGP276 (LpqF lipoprotein)
ProGP277 (LpqI)
ProGP278 (LpqN)
ProGP279 (LpqT (putative lipoprotein))
ProGP280 (LpqW (lipoprotein))
ProGP281 (LprF)
ProGP282 (prG)
ProGP283 (OppA)
ProGP284 (PonA2)
ProGP285 (PpiB)
ProGP286 (PstS2)
ProGP287 (PstS3)
ProGP288 (Rv0020c)
ProGP289 (Rv0281)
ProGP290 (Rv0907)
ProGP291 (Rv0988)
ProGP292 (Rv1084)
ProGP293 (Rv2813)
ProGP294 (Secreted protease)
ProGP295 (Thioredoxin)
ProGP296 (FlaA (Flagellin))
ProGP297 (FlaB (Flagellin))
ProGP298 (FliC (Flagellin subunit))
ProGP299 (CcoP)
ProGP300 (CycB)
ProGP301 (S-layer Protein)
ProGP302 (AniA)
ProGP303 (DsbA)
ProGP304 (Gna1946)
ProGP305 (Laz)
ProGP306 (Mip (Peptidyl-prolyl cis-trans isomerase
ProGP307 (PotF)
ProGP308 (Sco)
ProGP309 (PstS (40 kDa))
ProGP310 (Hypothetical protein)
ProGP311 (BF2494)
ProGP312 (Hypothetical protein)
ProGP313 (Hypothetical protein)
ProGP314 (Putative exported protein)
ProGP315 (Putative outer membrane protein)
ProGP316 (Srr1)
ProGP317 (BF3567)
ProGP318 (BF3918)
ProGP319 (BF0935)
ProGP320 (LppC)
ProGP321 (OmpA)
ProGP322 (EtpA Adhesin)
ProGP323 (JlpA (42-45 kDa antigen))
ProGP324 (FliC (Flagellin))
ProGP325 (FliC (Flagellin))
ProGP326 (FliC (Flagellin))
ProGP327 (LccA, an Archaeal Laccase)
ProGP328 (Extracellular matrix protein adhesin A (EmaA))
ProGP329 (FTH_1830)
ProGP330 (FTH_0159)
ProGP331 (FTH_1855)
ProGP332 (FTH_0539)
ProGP333 (FTH_1112)
ProGP334 (FTH_0311)
ProGP335 (FTH_1167)
ProGP336 (FTH_1761)
ProGP337 (FTH_1721)
ProGP338 (FTH_1293)
ProGP339 (FTH_0069)
ProGP340 (FTH_1071)
ProGP341 (FTH_0414)
ProGP342 (FTH_0357)
ProGP343 (PilA (FTH_0384))
ProGP344 (SlaA (S-layer protein))
ProGP345 (Mfa1 (67 kDa minor fimbrillin))
ProGP346 (Chondroitinase ABC)
ProGP347 (Spermidine/putrescine-binding protein (PotD))
ProGP348 (TfsB (S-layer protein))
ProGP349 (TF1259)
ProGP350 (TF2339)
ProGP351 (BF0810)
ProGP352 (Putative cell division protein)
ProGP353 (Putative exported protein)
ProGP354 (Putative non-specific DNA-binding protein)
ProGP355 (Cj0017c (Disulfide bond formation protein))
ProGP356 (Cj0081 (Cytochrome bd oxidase subunit I))
ProGP357 (Putative lipoprotein)
ProGP358 (Putative membrane protein)
ProGP359 (Putative membrane protein)
ProGP360 (Cj0235c (Putative protein export protein))
ProGP361 (Putative mechanosensitive ion channel family protein)
ProGP362 (Putative sulfatase family protein)
ProGP363 (Cj0277 (Rod shape-determining protein))
ProGP364 (Putative integral membrane protein)
ProGP365 (Cj0366c (Inner membrane multidrug efflux system protein CmeB))
ProGP366 (UPF0323 lipoprotein Cj0371)
ProGP367 (Putative uncharacterized protein)
ProGP368 (Colicin V production protein)
ProGP369 (Putative membrane protein)
ProGP370 (Putative exporting protein)
ProGP371 (Putative secreted protease)
ProGP372 (Putative periplasmic protein)
ProGP373 (Putative periplasmic protein)
ProGP374 (Putative integral membrane protein)
ProGP375 (Putative OmpA family membrane protein)
ProGP376 (Putative outer membrane efflux protein)
ProGP377 (Putative periplasmic protein)
ProGP378 (Putative membrane protein)
ProGP379 (Cj0652 (Penicillin-binding protein))
ProGP380 (Putative periplasmic protein)
ProGP381 (Cj0783 (Periplasmic nitrate reductase small subunit))
ProGP382 (Putative secreted transglycosylase)
ProGP383 (Uncharacterized metallophosphoesterase)
ProGP384 (Cj0982c (Putative amino acid transporter periplasmic solute-binding protein CjaA))
ProGP385 (Cj0983 (Putative lipoprotein))
ProGP386 (Putative mechanosensitive ion channel family protein)
ProGP387 (Putative cytochrome c biogenesis protein)
ProGP388 (Cj1032 (Membrane fusion component multidrug efflux system))
ProGP389 (Putative integral membrane protein)
ProGP390 (Putative sulfatase protein)
ProGP391 (Cj1126c (Oligosaccharyltransferase))
ProGP392 (Putative periplasmic protein)
ProGP393 (Putative integral membrane protein)
ProGP394 (Cj1444c (Capsule polysaccharide export system periplasmic protein))
ProGP395 (Cj1565c (Paralyzed flagellum protein))
ProGP396 (Putative periplasmic protein)
ProGP397 (Possible ABC transport system permease)
ProGP398 (Lectin LecB)
ProGP399 (TfsA (S-layer protein))
ProGP400 (Sublancin)
ProGP401 (Plantaricin ASM1)
ProGP402 (Glycocin F)
ProGP403 (FlaA (Flagellin))
ProGP404 (FlaB (Flagellin))
ProGP405 (TF0091)
ProGP406 (TF1056)
ProGP407 (EhaJ (autotranporter))
ProGP408 (FliC (Flagellin))
ProGP409 (FliC (Flagellin))
ProGP410 (DsbA)
ProGP411 (FTL_1096)
ProGP412 (OmpA/MotB)
ProGP413 (Putative Uncharacterized Protein)
ProGP414 (Putative Uncharacterized Protein)
ProGP415 (Putative Uncharacterized Protein)
ProGP416 (Putative Uncharacterized Protein)
ProGP417 (Putative Uncharacterized Protein)
ProGP418 (Putative Uncharacterized Protein)
ProGP419 (PilA)
ProGP420 (FlaA (Polar flagellin))
ProGP421 (FlaB (Polar flagellin))
ProGP422 (LafA (Lateral flagellin))
ProGP423 (AniA)
ProGP424 (Dipeptide ABC transporter, periplasmic dipeptide binding protein (dppA))
ProGP425 (ABC Transporter (TreS))
ProGP426 (Oligopeptide binding protein)
ProGP427 (Hypothetical protein)
ProGP428 (Protease)
ProGP429 (Maltose ABC transporter)
ProGP430 (Serine protease)
ProGP431 (Hypothetical protein)
ProGP432 (Hypothetical protein)
ProGP433 (Hypothetical protein)
ProGP434 (Arabinose ABC transporter, arabinose binding protein (AraS))
ProGP435 (FasC (fasciclin domain protein))
ProGP436 (Acm2)
ProGP437 (FliC (Type B Flagellin))
ProGP438 (DnaK)
ProGP439 (Lp_2260)
ProGP440 (Lp_2162)
ProGP441 (Lp_1643)
ProGP442 (PdhC)
ProGP443 (FtsY)
ProGP444 (Lp_ 2793)
ProGP445 (FtsK1)
ProGP446 (Lp_3421)
ProGP447 (FtsZ)
ProGP448 (MOMP)
ProGP449 (PsrP (Adhesin))
ProGP450 (AtaC)
ProGP451 (COK_1394)
ProGP452 (Probable conserved proline rich membrane protein (MT2222))
ProGP453 (Probable conserved MCE associated membrane protein)
ProGP454 (Rv1887)
ProGP455 (35kDa protein)
ProGP456 (Rv3835)
ProGP457 (LppO (Putative lipoprotein))
ProGP458 (ThuA)
ProGP459 (ABC-type amino acid transport system secreted component)
ProGP460 (Putative protein)
ProGP461 (Putative uncharacterized protein)
ProGP462 (Putative uncharacterized protein)
ProGP463 (Immunogenic protein MPT63)
ProGP464 (Putative protein)
ProGP465 (Immunogenic protein MPT63)
ProGP466 (Putative protein)
ProGP467 (Alanine and proline-rich secreted protei
ProGP468 (C-terminal protease)
ProGP469 (MdtA multidrug resistance protein)
ProGP470 (Putative uncharacterized protein)
ProGP471 (Putative uncharacterized protein)
ProGP472 (Putative signal peptide)
ProGP473 (Peptidoglycan-binding membrane protein)
ProGP474 (Putative phospholipid-binding lipoprotei
ProGP475 (Putative uncharacterized protein)
ProGP476 (Putative MCE (mammalian cell entry) related protein)
ProGP477 (Putative cell division related protein)
ProGP478 (Putative uncharacterized protein)
ProGP479 (Putative lipoprotein)
ProGP480 (Putative fusaric acid resistance transporter protein)
ProGP481 (CpxP-like protein)
ProGP482 (ComEA)
ProGP483 (Putative PRC barrel containing lipoprote
ProGP484 (Putative exported protein)
ProGP485 (oprM efflux system outer membrane protein)
ProGP486 (Putative membrane protein)
ProGP487 (OM lipoprotein carrier LolA)
ProGP488 (OmlA)
ProGP489 (Cell division protein)
ProGP490 (OmpA family protein)
ProGP491 (Putative uncharacterized protein)
ProGP492 (Type IV Pilin)
ProGP493 (CN)
ProGP494 (FliC (Flagellin))
ProGP495 (EF-P)
ProGP496 (PliA)
ProGP497 (Putative secretion protein)
ProGP498 (Uncharacterized protein)
ProGP499 (Uncharacterized protein)
ProGP500 (Uncharacterized protein)
ProGP501 (Uncharacterized protein)
ProGP502 (Uncharacterized protein)
ProGP503 (Uncharacterized protein)
ProGP504 (Uncharacterized protein)
ProGP505 (Laz (lipid-modified azurin))
ProGP506 (MetQ)
ProGP507 (Sco)
ProGP508 (Mip (Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA))
ProGP509 (Ccop)
ProGP510 (Translation elongation factor P (EF-P))
ProGP511 (Translation elongation factor P (EF-P))
ProGP512 (Enterocin F4-9)
ProGP513 (Knh)
ProGP514 (EmaA)
ProGP515 (NirK)
ProGP516 (C5)
ProGP517 (CcoP)
ProGP518 (Slg1 (S-layer glycoprotein))
ProGP519 (Slg2 (S-layer glycoprotein))
ProGP520 (Hag flagellin)
ProGP521 (EF-P)
ProGP522 (Putative membrane fusion protein)
ProGP523 (Probable lipoprotein transmembrane)
ProGP524 (Probable transmembrane protein)
ProGP525 (Hypothetical signal peptide protein)
ProGP526 (RagB)
ProGP527 (Probable tpr domain signal peptide protein)
ProGP528 (FtsN)
ProGP529 (AcrA)
ProGP530 (D-(?)-3-hydroxybutyrate oligomer hydrolase)
ProGP531 (Probable transmembrane protein)
ProGP532 (Probable serine protease protein)
ProGP533 (Probable m20-related peptidase)
ProGP534 (PilN)
ProGP535 (Probable lipoprotein)
ProGP536 (Probable transmembrane protein)
ProGP537 (Peptidyl-prolyl cis-trans isomerase)
ProGP538 (Probable transmembrane protein)
ProGP539 (PilA)
ProGP540 (Probable peptidase transmembrane protein)
ProGP541 (FtsL)
ProGP542 (Translation elongation factor P (EF-P))
ProGP543 (Flagellin A1)
ProGP544 (Flagellin A2)
ProGP545 (Pilin A1)
ProGP546 (Pilin A2)
ProGP547 (Pilin A3)
ProGP548 (Pilin A4)
ProGP549 (Pilin A6)
ProGP550 (Pls (Plasmin sensitive surface protein))
ProGP551 (Pls (Plasmin sensitive surface protein))
ProGP552 (Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96)
ProGP553 (Hypothetical protein)
ProGP554 (Hypothetical protein)
ProGP555 (Hypothetical protein)
ProGP556 (Arabinase)
ProGP557 (Hypothetical protein)
ProGP558 (ABC transporter substrate binding protei
ProGP559 (Pullulanase)
ProGP560 (Hypothetical protein)
ProGP561 (Hypothetical protein)
ProGP562 (Hypothetical protein)
ProGP563 (Pullulanase)
ProGP564 (Hypothetical protein)
ProGP565 (Peptide binding protein)
ProGP566 (Multidrug RND transporter)
ProGP567 (Molybdopterin oxidoreductase)
ProGP568 (Cytochrome c biogenesis protein)
ProGP569 (Hypothetical protein)
ProGP570 (Peptide transporter)
ProGP571 (Hypothetical protein)
ProGP572 (Hypothetical protein)
ProGP573 (Hypothetical protein)
ProGP574 (Peptide transporter)
ProGP575 (Hypothetical protein)
ProGP576 (Penicillin amidase)
ProGP577 (Nitric-oxide reductase large subunit)
ProGP578 (Cytochrome c biogenesis protein)
ProGP579 (Hypothetical protein)
ProGP580 (Histidine kinase)
ProGP581 (Cytochrome c assembly)
ProGP582 (Metallophosphoesterase)
ProGP583 (ATP synthase subunit A)
ProGP584 (Hypothetical protein)
ProGP585 (Hypothetical protein)
ProGP586 (Hypothetical protein)
ProGP587 (Chloride channel protein)
ProGP588 (Hypothetical protein)
ProGP589 (Thermosome subunit)
ProGP590 (Hypothetical protein)
ProGP591 (Peptide ABC transporter substrate bindin protein)
ProGP592 (Peptidase)
ProGP593 (Hypothetical protein)
ProGP594 (ABC transporter substrate binding protei
ProGP595 (Glycosyl transferase)
ProGP596 (Nitrate reductase beta subunit)
ProGP597 (Hypothetical protein)
ProGP598 (Peptidase M50)
ProGP599 (Hypothetical protein)
ProGP600 (Hypothetical protein)
ProGP601 (Transglutaminase)
ProGP602 (FAD-dependent oxidoreductase)
ProGP603 (ABC transporter substrate binding protein)
ProGP604 (Iron ABC transporter substrate binding protein)
ProGP605 (Hypothetical protein branched chain amino acid ABC transporter substrate binding protein
ProGP606 (ABC transporter substrate binding protein)
ProGP607 (Geranylgeranyl reductase)
ProGP608 (Sugar ABC transporter substrate binding protein)
ProGP609 (Hypothetical protein)
ProGP610 (Hypothetical protein)
ProGP611 (Phosphate starvation protein PhoH)
ProGP612 (ABC transporter)
ProGP613 (Nitrous oxidase accessory protein)
ProGP614 (Glutamate dehydrogenase)
ProGP615 (Hypothetical protein)
ProGP616 (NADH dehydrogenase subunit D)
ProGP617 (Nodulation efficiency protein NfeD)
ProGP618 (Hypothetical protein)
ProGP619 (Hypothetical protein)
ProGP620 (Hypothetical protein)
ProGP621 (Sugar binding protein)
ProGP622 (NADH-ubiquinone oxidoreductase)
ProGP623 (Hypothetical protein)
ProGP624 (Branched chain amino acid ABC transporter substrate binding protein)
ProGP625 (Hypothetical protein)
ProGP626 (Serpin)
ProGP627 (Hypothetical protein)
ProGP628 (ABC transporter substrate binding protein)
ProGP629 (ATPase)
ProGP630 (Hypothetical protein)
ProGP631 (ABC transporter)
ProGP632 (ABC transporter substrate binding protein)
ProGP633 (Hypothetical protein)
ProGP634 (Peptide ABC transporter permease)
ProGP635 (TRAP ABC transporter)
ProGP636 (NosD)
ProGP637 (Cytochrome c biogenesis protein)
ProGP638 (Excisionase)
ProGP639 (ABC transporter periplasmic binding protein)
ProGP640 (Primosomal protein)
ProGP641 (Hypothetical protein)
ProGP642 (Cytochrome c assembly protein)
ProGP643 (Glycosyltransferase)
ProGP644 (Hypothetical protein)
ProGP645 (ABC transporter substrate binding protein)
ProGP646 (Glycosyltransferase)
ProGP647 (Hypothetical protein)
ProGP648 (Nitrate reductase)
ProGP649 (Transcriptional regulator)
ProGP650 (Hypothetical protein)
ProGP651 (4Fe-4S ferredoxin)
ProGP652 (Amino acid ABC transporter substrate binding protein)
ProGP653 (Hypothetical protein)
ProGP654 (SCO1/SenC)
ProGP655 (Hypothetical protein)
ProGP656 (RNA methyltransferase)
ProGP657 (Transcriptional regulator)
ProGP658 (Hypothetical protein)
ProGP659 (Hypothetical protein)
ProGP660 (Hypothetical protein)
ProGP661 (Eight cysteine cluster domain containing protein)
ProGP662 (30S ribosomal protein S2)
ProGP663 (Protein disulfide isomerase like protein)
ProGP664 (V-type ATPase subunit D)
ProGP665 (ABC transporter)
ProGP666 (ABC transporter)
ProGP667 (V-type ATP synthase subunit E)
ProGP668 (Hypothetical protein)
ProGP669 (ABC transporter)
ProGP670 (Hypothetical protein)
ProGP671 (Hypothetical protein)
ProGP672 (Hypothetical protein)
ProGP673 (FHA domain containing protein)
ProGP674 (Hypothetical protein)
ProGP675 (Hypothetical protein)
ProGP676 (Hypothetical protein)
ProGP677 (Hypothetical protein)
ProGP678 (Hypothetical protein)
ProGP679 (Nitrate reductase alpha subunit)
ProGP680 (Peptidase S8)
ProGP681 (Formate dehydrogenase)
ProGP682 (Flagellin)
ProGP683 (Flagellin)
ProGP684 (WpaA)
ProGP685 (Cnm)
Compare ID
Choose Compare Id
ProGP1 (Envelope specific glycoprotein)
ProGP2 (Phytotoxin)
ProGP3 (S-layer glycoprotein)
ProGP4 (F-pilin)
ProGP5 (Factor PG-1)
ProGP6 (Cellulase CA)
ProGP7 (Cellulase CB)
ProGP8 (Membrane glycoprotein 152 kDa )
ProGP9 (8 kDa fimbrae)
ProGP10 (Flagellin)
ProGP11 (Autolysin (28 kDa))
ProGP12 (12 kDa antigen)
ProGP13 (33 kDa antigen)
ProGP14 (Membrane glycoprotein)
ProGP15 (N-acetylmuramoylhydrolase (Muramidase-2))
ProGP16 (50 kDa antigen)
ProGP17 (Flagellin)
ProGP18 (S-layer glycoprotein SgsE)
ProGP19 (Outer membrane protein (26.5 kDa))
ProGP20 (Outer membrane protein (50 kDa))
ProGP21 (Outer membrane protein (75 kDa))
ProGP22 (Flagellin FlaB1)
ProGP23 (Flagellin FlaB2)
ProGP24 (Flagellin FlaB3)
ProGP25 (33 and 34 kDa antigens)
ProGP26 (CenA (Endoglucanase A))
ProGP27 (Cex (Exoglucanase or xylanase))
ProGP28 (Flagellin A1)
ProGP29 (Flagellin A2)
ProGP30 (Flagellin B1)
ProGP31 (Flagellin B2)
ProGP32 (Flagellin B3)
ProGP33 (Streptococcal acid glycoprotein SAGP)
ProGP34 (S-layer glycoprotein)
ProGP35 (?-1,4-Endoglucanases)
ProGP36 (S-layer glycoprotein)
ProGP37 (S-layer glycoprotein)
ProGP38 (VGP (74 kDa))
ProGP39 (Acidic glycoproteins (133-155 kDa))
ProGP40 (Long-fibril protein (LFP))
ProGP41 (HPI (hexagonally packed intermediate) layer polypepetide)
ProGP42 (Cellobiosidase)
ProGP43 (SlgA (cell surface glycoprotein))
ProGP44 (S-layer glycoprotein)
ProGP45 (S-layer glycoprotein (94 kDa))
ProGP46 (S-layer glycoprotein (90 kDa))
ProGP47 (S-layer glycoprotein (92 kDa))
ProGP48 (S-layer glycoprotein)
ProGP49 (S-layer glycoprotein)
ProGP50 (Flagellin A)
ProGP51 (Alanine and proline-rich secreted protein Apa (50/55-kDa or 45 kDa MPT 32))
ProGP52 (Hypothetical protein)
ProGP53 (33 kDa minor core flagellin)
ProGP54 (34 kDa major core flagellin)
ProGP55 (Cell surface protein/S-layer protein)
ProGP56 (Cellulolosome complex (Cellulosomal-scaffolding protein A))
ProGP57 (38 kDa antigen)
ProGP58 (Thermopsin)
ProGP59 (?-1, 4-D-glucosidase (51 kDa))
ProGP60 (S-layer glycoprotein (118 kDa))
ProGP61 (S-layer glycoprotein (132 kDa))
ProGP62 (18 kDa and 32 kDa lectin binding proteins
ProGP63 (Xylanase B (Endo-1,4-beta-xylanase B))
ProGP64 (15 kDa-phosphate containing glycoprotein)
ProGP65 (24 kDa flagellin)
ProGP66 (25 kDa flagellin)
ProGP67 (35 kDa flagellin)
ProGP68 (S-layer glycoprotein)
ProGP69 (S-layer glycoprotein)
ProGP70 ((1,3-1,4)-beta-glucanase (MAC))
ProGP71 (S-layer glycoprotein)
ProGP72 (Alkaline Phosphatase D)
ProGP73 (p115/ PAAP)
ProGP74 (H(A107-M) (1,3-1,4)-beta-glucanase)
ProGP75 (S-layer glycoprotein)
ProGP76 (Cell surface lipoprotein MPB83 (25/23-kDa antigen))
ProGP77 (Major outer membrane protein (MOMP, 40 kD))
ProGP78 (Cell surface glycoprotein (SlgA))
ProGP79 (S-layer glycoprotein)
ProGP80 (S-layer glycoprotein (115 kDa protein))
ProGP81 (S-layer glycoprotein)
ProGP82 (Ice nucleation lipoglycoprotein)
ProGP83 (Ice nucleation lipoglycoprotein)
ProGP84 (Auracyanin-B1 (22 kDa))
ProGP85 (Auracyanin-B2 (18 kDa))
ProGP86 (Cellulase complex (230 kDa subunit))
ProGP87 (Cellulase (30 kDa) and Xylanase (15.7 kDa))
ProGP88 (S-layer glycoprotein)
ProGP89 (Surface layer glycoprotein)
ProGP90 (Antigens)
ProGP91 (S-layer glycoprotein (82 kDa))
ProGP92 (Anitigen (1000 kDa protein))
ProGP93 (Protein complex)
ProGP94 (Surface layer glycoprotein)
ProGP95 (S-layer glycoprotein)
ProGP96 (PS2 (S-layer glycoprotein))
ProGP97 (27kDa flagellin)
ProGP98 (32kDa flagellin)
ProGP99 (PilE (pilin))
ProGP100 (PF sheath protein (44 kDa))
ProGP101 (H(A16-M) (1,3-1,4)-beta-glucanase)
ProGP102 (Flagellin B1)
ProGP103 (Flagellin B2)
ProGP104 (S-layer glycoprotein (138 kDa))
ProGP105 (S-layer glycoprotein)
ProGP106 (Heparin lyase I or Heparinase I)
ProGP107 (Fimbrial protein (pilin); (group I T4P))
ProGP108 (Tetrabrachion (S layer glycoprotein))
ProGP109 (Stable protease)
ProGP110 (45 to 47-kDa protein)
ProGP111 (S-layer glycoprotein)
ProGP112 (72-kDa glycoprotein (ExsJ))
ProGP113 (Flagellin Laf1)
ProGP114 (Endo-?-N-acetylglucosaminidase F2)
ProGP115 (Flavastacin (P40))
ProGP116 (Endo-?-N-acetylglucosaminidase F3)
ProGP117 (Cell surface glycoprotein (S-layer protein))
ProGP118 (Flagellin)
ProGP119 (Fimbrial protein (pilin))
ProGP120 (Protein A (cell wall glycoprotein))
ProGP121 (Surface layer glycoprotein Sat B)
ProGP122 (Surface layer glycoprotein SatA)
ProGP123 (CRX (Copper response extracellular protein))
ProGP124 (?-1,4-mannanase)
ProGP125 (Flagellin)
ProGP126 (31/33 kDa flagellin)
ProGP127 (Flagellin B1 (41 kDa))
ProGP128 (wmA (S-layer protein))
ProGP129 (RU 41740-P1 Glyoprotein fraction (non endotoxin))
ProGP130 (Pyrolysin)
ProGP131 (Cell surface phosphatase)
ProGP132 (Chondroitinase-AC)
ProGP133 (Heparinase II)
ProGP134 (Exopolymer)
ProGP135 (37-kDa protein)
ProGP136 (Antigen (60 kDa))
ProGP137 (Oscillin (65.8 kDa))
ProGP138 (Cell surface glycoprotein)
ProGP139 (S-layer glycoprotein)
ProGP140 (?-Glucosidase (thermostable) 160 kDa)
ProGP141 (PGP)
ProGP142 (Antifreeze protein)
ProGP143 (S-layer glycoprotein (101 kDa))
ProGP144 (S-layer glycoprotein (120 kDa))
ProGP145 (Adhesion inhibitor)
ProGP146 (Flagellin)
ProGP147 (S-layer glycoprotein (29 kDa, forms tetramer))
ProGP148 (?-1,4-mannanase (G-enzyme))
ProGP149 (Crystal toxin (66 kDa))
ProGP150 (Cytochrome b558/566 subunit A (b type hemoprotein))
ProGP151 (P 110 (Adhesin-like glycoprotein 110 kDa))
ProGP152 (Type A Flagellin)
ProGP153 (Flagellin)
ProGP154 (Flagellin)
ProGP155 (Flagellin)
ProGP156 (AnAF)
ProGP157 (HBHA (heparin-binding hemagglutinin))
ProGP158 (FlaB (flagellar core protein))
ProGP159 (FlaB (flagellar core protein))
ProGP160 (Flagellar filament 31.3 kDa core protein
ProGP161 (FlaB (flagellar core protein))
ProGP162 (FlaB (flagellar core protein))
ProGP163 (FlaB (flagellar core protein))
ProGP164 (FlaB (flagellar core protein))
ProGP165 (S-layer glycopeptide)
ProGP166 (Chondroitinase-B)
ProGP167 (BclA (collagen-like protein))
ProGP168 (Slp (S-layer glycoprotein))
ProGP169 (Surface layer glycoproteins)
ProGP170 (Cysteine proteases (extracellular) Arg-gingipains (RgpA))
ProGP171 (Man26A (b-mannosidase 26A))
ProGP172 (S-layer glycoprotein)
ProGP173 (GBP (Glucose binding protein)/GlcS)
ProGP174 (Flagellin A)
ProGP175 (Flagellin B)
ProGP176 (TibA (outer membrane protein synthesized as preTibA))
ProGP177 (HRgpA)
ProGP178 (mtRgpA)
ProGP179 (S-layer glycoprotein)
ProGP180 (S-layer glycoprotein (27 kDa))
ProGP181 (P140 (140 kDa protein))
ProGP182 (P120 (120 kDa protein))
ProGP183 (GlnH)
ProGP184 (Mpt83 (Cell surface lipoprotein))
ProGP185 (Invertase)
ProGP186 (98-kDa ,58-kDa, 54-kDa glycoproteins)
ProGP187 (flaA)
ProGP188 (flaB)
ProGP189 (Superoxide dismutase [Cu-Zn])
ProGP190 (LppN lipoprotein)
ProGP191 (LppQ lipoprotein)
ProGP192 (LpqH)
ProGP193 (PstS1)
ProGP194 (PS4A (water soluble protein-polysaccharide))
ProGP195 (Streptococcal acid glycoprotein SAGP)
ProGP196 (ComP)
ProGP197 (Subtilisin (SBL)-Cys mutant)
ProGP198 (Flagellin)
ProGP199 (Flagellin)
ProGP200 (Laminin-binding glycoprotein (MS-LBP) or histone-like protein)
ProGP201 (Diffuse Adherence Adhesin (AIDA-I))
ProGP202 (TMBP (Trehalose/maltose binding protein)
ProGP203 (Cell envelope glycoprotein)
ProGP204 (CbtA (Cellobiose binding protein)
ProGP205 (Flagellin A (FlaA))
ProGP206 (Flagellin (FlaA))
ProGP207 (Glycopeptidolipid (GPL))
ProGP208 (SbsD (S-layer glycoprotein))
ProGP209 (Fap1 (Fimbrial adhesin))
ProGP210 (Protein-serine/threonine kinase (SsoPK1)
ProGP211 (TMBP (Trehalose/maltose binding protein)
ProGP212 (MDBP (Maltodextrin binding protein))
ProGP213 (95-kDa glycoprotein)
ProGP214 (Flagellin B)
ProGP215 (Flagellin A (FlaA))
ProGP216 (BclA (collagen-like protein))
ProGP217 (AcrA or CmeA)
ProGP218 (CgpA)
ProGP219 (Cj0114)
ProGP220 (Cj0200c)
ProGP221 (Cj1496c)
ProGP222 (PEB3)
ProGP223 (ZnuA)
ProGP224 (Flagellin)
ProGP225 (Flagellin)
ProGP226 (Flagellin)
ProGP227 (HMW1 (Adhesin))
ProGP228 (Short glycopeptides)
ProGP229 (GspB)
ProGP230 (PilA (Type IV pilin))
ProGP231 (VirB10 protein)
ProGP232 (Flagellin FlaA)
ProGP233 (Resuscitation promoting factor 2 (Rpf2))
ProGP234 (CipA (conserved hypothetical protein))
ProGP235 (CipB (putative dipeptide-binding protein
ProGP236 (HisJ)
ProGP237 (SgtA)
ProGP238 (FlaB1)
ProGP239 (FlaB2)
ProGP240 (FlaB3)
ProGP241 (FlaA)
ProGP242 (S-layer protein)
ProGP243 (Synthetic Glycopeptide)
ProGP244 (SrpA)
ProGP245 (SraP (serine-rich adhesin for platelets)
ProGP246 (BclB (collagen-like protein))
ProGP247 (Flagellin A)
ProGP248 (Flagellin B)
ProGP249 (Ag43? (Antigen 43 passenger domain))
ProGP250 (PilA (Pilin))
ProGP251 (Type b Flagellin)
ProGP252 (DgpA)
ProGP253 (DgpC)
ProGP254 (Dps (18 kDa), Stress inducible DNA binding protein)
ProGP255 (HmcA)
ProGP256 (CmeC)
ProGP257 (Microcystin-related protein C (MrpC))
ProGP258 (FlaB3)
ProGP259 (FlaB1)
ProGP260 (FlaB2)
ProGP261 (Flagellin (FlaA))
ProGP262 (Pillin (Group IV))
ProGP263 (Rv3491)
ProGP264 (Glycosyl hydrolase)
ProGP265 (Rv2799)
ProGP266 (LprA)
ProGP267 (GgtB)
ProGP268 (BfrB)
ProGP269 (Bglu)
ProGP270 (BlaC)
ProGP271 (FecB)
ProGP272 (LppL)
ProGP273 (LppX (Putative lipoprotein))
ProGP274 (LppZ (Putative lipoprotein))
ProGP275 (LpqB lipoprotein)
ProGP276 (LpqF lipoprotein)
ProGP277 (LpqI)
ProGP278 (LpqN)
ProGP279 (LpqT (putative lipoprotein))
ProGP280 (LpqW (lipoprotein))
ProGP281 (LprF)
ProGP282 (prG)
ProGP283 (OppA)
ProGP284 (PonA2)
ProGP285 (PpiB)
ProGP286 (PstS2)
ProGP287 (PstS3)
ProGP288 (Rv0020c)
ProGP289 (Rv0281)
ProGP290 (Rv0907)
ProGP291 (Rv0988)
ProGP292 (Rv1084)
ProGP293 (Rv2813)
ProGP294 (Secreted protease)
ProGP295 (Thioredoxin)
ProGP296 (FlaA (Flagellin))
ProGP297 (FlaB (Flagellin))
ProGP298 (FliC (Flagellin subunit))
ProGP299 (CcoP)
ProGP300 (CycB)
ProGP301 (S-layer Protein)
ProGP302 (AniA)
ProGP303 (DsbA)
ProGP304 (Gna1946)
ProGP305 (Laz)
ProGP306 (Mip (Peptidyl-prolyl cis-trans isomerase
ProGP307 (PotF)
ProGP308 (Sco)
ProGP309 (PstS (40 kDa))
ProGP310 (Hypothetical protein)
ProGP311 (BF2494)
ProGP312 (Hypothetical protein)
ProGP313 (Hypothetical protein)
ProGP314 (Putative exported protein)
ProGP315 (Putative outer membrane protein)
ProGP316 (Srr1)
ProGP317 (BF3567)
ProGP318 (BF3918)
ProGP319 (BF0935)
ProGP320 (LppC)
ProGP321 (OmpA)
ProGP322 (EtpA Adhesin)
ProGP323 (JlpA (42-45 kDa antigen))
ProGP324 (FliC (Flagellin))
ProGP325 (FliC (Flagellin))
ProGP326 (FliC (Flagellin))
ProGP327 (LccA, an Archaeal Laccase)
ProGP328 (Extracellular matrix protein adhesin A (EmaA))
ProGP329 (FTH_1830)
ProGP330 (FTH_0159)
ProGP331 (FTH_1855)
ProGP332 (FTH_0539)
ProGP333 (FTH_1112)
ProGP334 (FTH_0311)
ProGP335 (FTH_1167)
ProGP336 (FTH_1761)
ProGP337 (FTH_1721)
ProGP338 (FTH_1293)
ProGP339 (FTH_0069)
ProGP340 (FTH_1071)
ProGP341 (FTH_0414)
ProGP342 (FTH_0357)
ProGP343 (PilA (FTH_0384))
ProGP344 (SlaA (S-layer protein))
ProGP345 (Mfa1 (67 kDa minor fimbrillin))
ProGP346 (Chondroitinase ABC)
ProGP347 (Spermidine/putrescine-binding protein (PotD))
ProGP348 (TfsB (S-layer protein))
ProGP349 (TF1259)
ProGP350 (TF2339)
ProGP351 (BF0810)
ProGP352 (Putative cell division protein)
ProGP353 (Putative exported protein)
ProGP354 (Putative non-specific DNA-binding protein)
ProGP355 (Cj0017c (Disulfide bond formation protein))
ProGP356 (Cj0081 (Cytochrome bd oxidase subunit I))
ProGP357 (Putative lipoprotein)
ProGP358 (Putative membrane protein)
ProGP359 (Putative membrane protein)
ProGP360 (Cj0235c (Putative protein export protein))
ProGP361 (Putative mechanosensitive ion channel family protein)
ProGP362 (Putative sulfatase family protein)
ProGP363 (Cj0277 (Rod shape-determining protein))
ProGP364 (Putative integral membrane protein)
ProGP365 (Cj0366c (Inner membrane multidrug efflux system protein CmeB))
ProGP366 (UPF0323 lipoprotein Cj0371)
ProGP367 (Putative uncharacterized protein)
ProGP368 (Colicin V production protein)
ProGP369 (Putative membrane protein)
ProGP370 (Putative exporting protein)
ProGP371 (Putative secreted protease)
ProGP372 (Putative periplasmic protein)
ProGP373 (Putative periplasmic protein)
ProGP374 (Putative integral membrane protein)
ProGP375 (Putative OmpA family membrane protein)
ProGP376 (Putative outer membrane efflux protein)
ProGP377 (Putative periplasmic protein)
ProGP378 (Putative membrane protein)
ProGP379 (Cj0652 (Penicillin-binding protein))
ProGP380 (Putative periplasmic protein)
ProGP381 (Cj0783 (Periplasmic nitrate reductase small subunit))
ProGP382 (Putative secreted transglycosylase)
ProGP383 (Uncharacterized metallophosphoesterase)
ProGP384 (Cj0982c (Putative amino acid transporter periplasmic solute-binding protein CjaA))
ProGP385 (Cj0983 (Putative lipoprotein))
ProGP386 (Putative mechanosensitive ion channel family protein)
ProGP387 (Putative cytochrome c biogenesis protein)
ProGP388 (Cj1032 (Membrane fusion component multidrug efflux system))
ProGP389 (Putative integral membrane protein)
ProGP390 (Putative sulfatase protein)
ProGP391 (Cj1126c (Oligosaccharyltransferase))
ProGP392 (Putative periplasmic protein)
ProGP393 (Putative integral membrane protein)
ProGP394 (Cj1444c (Capsule polysaccharide export system periplasmic protein))
ProGP395 (Cj1565c (Paralyzed flagellum protein))
ProGP396 (Putative periplasmic protein)
ProGP397 (Possible ABC transport system permease)
ProGP398 (Lectin LecB)
ProGP399 (TfsA (S-layer protein))
ProGP400 (Sublancin)
ProGP401 (Plantaricin ASM1)
ProGP402 (Glycocin F)
ProGP403 (FlaA (Flagellin))
ProGP404 (FlaB (Flagellin))
ProGP405 (TF0091)
ProGP406 (TF1056)
ProGP407 (EhaJ (autotranporter))
ProGP408 (FliC (Flagellin))
ProGP409 (FliC (Flagellin))
ProGP410 (DsbA)
ProGP411 (FTL_1096)
ProGP412 (OmpA/MotB)
ProGP413 (Putative Uncharacterized Protein)
ProGP414 (Putative Uncharacterized Protein)
ProGP415 (Putative Uncharacterized Protein)
ProGP416 (Putative Uncharacterized Protein)
ProGP417 (Putative Uncharacterized Protein)
ProGP418 (Putative Uncharacterized Protein)
ProGP419 (PilA)
ProGP420 (FlaA (Polar flagellin))
ProGP421 (FlaB (Polar flagellin))
ProGP422 (LafA (Lateral flagellin))
ProGP423 (AniA)
ProGP424 (Dipeptide ABC transporter, periplasmic dipeptide binding protein (dppA))
ProGP425 (ABC Transporter (TreS))
ProGP426 (Oligopeptide binding protein)
ProGP427 (Hypothetical protein)
ProGP428 (Protease)
ProGP429 (Maltose ABC transporter)
ProGP430 (Serine protease)
ProGP431 (Hypothetical protein)
ProGP432 (Hypothetical protein)
ProGP433 (Hypothetical protein)
ProGP434 (Arabinose ABC transporter, arabinose binding protein (AraS))
ProGP435 (FasC (fasciclin domain protein))
ProGP436 (Acm2)
ProGP437 (FliC (Type B Flagellin))
ProGP438 (DnaK)
ProGP439 (Lp_2260)
ProGP440 (Lp_2162)
ProGP441 (Lp_1643)
ProGP442 (PdhC)
ProGP443 (FtsY)
ProGP444 (Lp_ 2793)
ProGP445 (FtsK1)
ProGP446 (Lp_3421)
ProGP447 (FtsZ)
ProGP448 (MOMP)
ProGP449 (PsrP (Adhesin))
ProGP450 (AtaC)
ProGP451 (COK_1394)
ProGP452 (Probable conserved proline rich membrane protein (MT2222))
ProGP453 (Probable conserved MCE associated membrane protein)
ProGP454 (Rv1887)
ProGP455 (35kDa protein)
ProGP456 (Rv3835)
ProGP457 (LppO (Putative lipoprotein))
ProGP458 (ThuA)
ProGP459 (ABC-type amino acid transport system secreted component)
ProGP460 (Putative protein)
ProGP461 (Putative uncharacterized protein)
ProGP462 (Putative uncharacterized protein)
ProGP463 (Immunogenic protein MPT63)
ProGP464 (Putative protein)
ProGP465 (Immunogenic protein MPT63)
ProGP466 (Putative protein)
ProGP467 (Alanine and proline-rich secreted protei
ProGP468 (C-terminal protease)
ProGP469 (MdtA multidrug resistance protein)
ProGP470 (Putative uncharacterized protein)
ProGP471 (Putative uncharacterized protein)
ProGP472 (Putative signal peptide)
ProGP473 (Peptidoglycan-binding membrane protein)
ProGP474 (Putative phospholipid-binding lipoprotei
ProGP475 (Putative uncharacterized protein)
ProGP476 (Putative MCE (mammalian cell entry) related protein)
ProGP477 (Putative cell division related protein)
ProGP478 (Putative uncharacterized protein)
ProGP479 (Putative lipoprotein)
ProGP480 (Putative fusaric acid resistance transporter protein)
ProGP481 (CpxP-like protein)
ProGP482 (ComEA)
ProGP483 (Putative PRC barrel containing lipoprote
ProGP484 (Putative exported protein)
ProGP485 (oprM efflux system outer membrane protein)
ProGP486 (Putative membrane protein)
ProGP487 (OM lipoprotein carrier LolA)
ProGP488 (OmlA)
ProGP489 (Cell division protein)
ProGP490 (OmpA family protein)
ProGP491 (Putative uncharacterized protein)
ProGP492 (Type IV Pilin)
ProGP493 (CN)
ProGP494 (FliC (Flagellin))
ProGP495 (EF-P)
ProGP496 (PliA)
ProGP497 (Putative secretion protein)
ProGP498 (Uncharacterized protein)
ProGP499 (Uncharacterized protein)
ProGP500 (Uncharacterized protein)
ProGP501 (Uncharacterized protein)
ProGP502 (Uncharacterized protein)
ProGP503 (Uncharacterized protein)
ProGP504 (Uncharacterized protein)
ProGP505 (Laz (lipid-modified azurin))
ProGP506 (MetQ)
ProGP507 (Sco)
ProGP508 (Mip (Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA))
ProGP509 (Ccop)
ProGP510 (Translation elongation factor P (EF-P))
ProGP511 (Translation elongation factor P (EF-P))
ProGP512 (Enterocin F4-9)
ProGP513 (Knh)
ProGP514 (EmaA)
ProGP515 (NirK)
ProGP516 (C5)
ProGP517 (CcoP)
ProGP518 (Slg1 (S-layer glycoprotein))
ProGP519 (Slg2 (S-layer glycoprotein))
ProGP520 (Hag flagellin)
ProGP521 (EF-P)
ProGP522 (Putative membrane fusion protein)
ProGP523 (Probable lipoprotein transmembrane)
ProGP524 (Probable transmembrane protein)
ProGP525 (Hypothetical signal peptide protein)
ProGP526 (RagB)
ProGP527 (Probable tpr domain signal peptide protein)
ProGP528 (FtsN)
ProGP529 (AcrA)
ProGP530 (D-(?)-3-hydroxybutyrate oligomer hydrolase)
ProGP531 (Probable transmembrane protein)
ProGP532 (Probable serine protease protein)
ProGP533 (Probable m20-related peptidase)
ProGP534 (PilN)
ProGP535 (Probable lipoprotein)
ProGP536 (Probable transmembrane protein)
ProGP537 (Peptidyl-prolyl cis-trans isomerase)
ProGP538 (Probable transmembrane protein)
ProGP539 (PilA)
ProGP540 (Probable peptidase transmembrane protein)
ProGP541 (FtsL)
ProGP542 (Translation elongation factor P (EF-P))
ProGP543 (Flagellin A1)
ProGP544 (Flagellin A2)
ProGP545 (Pilin A1)
ProGP546 (Pilin A2)
ProGP547 (Pilin A3)
ProGP548 (Pilin A4)
ProGP549 (Pilin A6)
ProGP550 (Pls (Plasmin sensitive surface protein))
ProGP551 (Pls (Plasmin sensitive surface protein))
ProGP552 (Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96)
ProGP553 (Hypothetical protein)
ProGP554 (Hypothetical protein)
ProGP555 (Hypothetical protein)
ProGP556 (Arabinase)
ProGP557 (Hypothetical protein)
ProGP558 (ABC transporter substrate binding protei
ProGP559 (Pullulanase)
ProGP560 (Hypothetical protein)
ProGP561 (Hypothetical protein)
ProGP562 (Hypothetical protein)
ProGP563 (Pullulanase)
ProGP564 (Hypothetical protein)
ProGP565 (Peptide binding protein)
ProGP566 (Multidrug RND transporter)
ProGP567 (Molybdopterin oxidoreductase)
ProGP568 (Cytochrome c biogenesis protein)
ProGP569 (Hypothetical protein)
ProGP570 (Peptide transporter)
ProGP571 (Hypothetical protein)
ProGP572 (Hypothetical protein)
ProGP573 (Hypothetical protein)
ProGP574 (Peptide transporter)
ProGP575 (Hypothetical protein)
ProGP576 (Penicillin amidase)
ProGP577 (Nitric-oxide reductase large subunit)
ProGP578 (Cytochrome c biogenesis protein)
ProGP579 (Hypothetical protein)
ProGP580 (Histidine kinase)
ProGP581 (Cytochrome c assembly)
ProGP582 (Metallophosphoesterase)
ProGP583 (ATP synthase subunit A)
ProGP584 (Hypothetical protein)
ProGP585 (Hypothetical protein)
ProGP586 (Hypothetical protein)
ProGP587 (Chloride channel protein)
ProGP588 (Hypothetical protein)
ProGP589 (Thermosome subunit)
ProGP590 (Hypothetical protein)
ProGP591 (Peptide ABC transporter substrate bindin protein)
ProGP592 (Peptidase)
ProGP593 (Hypothetical protein)
ProGP594 (ABC transporter substrate binding protei
ProGP595 (Glycosyl transferase)
ProGP596 (Nitrate reductase beta subunit)
ProGP597 (Hypothetical protein)
ProGP598 (Peptidase M50)
ProGP599 (Hypothetical protein)
ProGP600 (Hypothetical protein)
ProGP601 (Transglutaminase)
ProGP602 (FAD-dependent oxidoreductase)
ProGP603 (ABC transporter substrate binding protein)
ProGP604 (Iron ABC transporter substrate binding protein)
ProGP605 (Hypothetical protein branched chain amino acid ABC transporter substrate binding protein
ProGP606 (ABC transporter substrate binding protein)
ProGP607 (Geranylgeranyl reductase)
ProGP608 (Sugar ABC transporter substrate binding protein)
ProGP609 (Hypothetical protein)
ProGP610 (Hypothetical protein)
ProGP611 (Phosphate starvation protein PhoH)
ProGP612 (ABC transporter)
ProGP613 (Nitrous oxidase accessory protein)
ProGP614 (Glutamate dehydrogenase)
ProGP615 (Hypothetical protein)
ProGP616 (NADH dehydrogenase subunit D)
ProGP617 (Nodulation efficiency protein NfeD)
ProGP618 (Hypothetical protein)
ProGP619 (Hypothetical protein)
ProGP620 (Hypothetical protein)
ProGP621 (Sugar binding protein)
ProGP622 (NADH-ubiquinone oxidoreductase)
ProGP623 (Hypothetical protein)
ProGP624 (Branched chain amino acid ABC transporter substrate binding protein)
ProGP625 (Hypothetical protein)
ProGP626 (Serpin)
ProGP627 (Hypothetical protein)
ProGP628 (ABC transporter substrate binding protein)
ProGP629 (ATPase)
ProGP630 (Hypothetical protein)
ProGP631 (ABC transporter)
ProGP632 (ABC transporter substrate binding protein)
ProGP633 (Hypothetical protein)
ProGP634 (Peptide ABC transporter permease)
ProGP635 (TRAP ABC transporter)
ProGP636 (NosD)
ProGP637 (Cytochrome c biogenesis protein)
ProGP638 (Excisionase)
ProGP639 (ABC transporter periplasmic binding protein)
ProGP640 (Primosomal protein)
ProGP641 (Hypothetical protein)
ProGP642 (Cytochrome c assembly protein)
ProGP643 (Glycosyltransferase)
ProGP644 (Hypothetical protein)
ProGP645 (ABC transporter substrate binding protein)
ProGP646 (Glycosyltransferase)
ProGP647 (Hypothetical protein)
ProGP648 (Nitrate reductase)
ProGP649 (Transcriptional regulator)
ProGP650 (Hypothetical protein)
ProGP651 (4Fe-4S ferredoxin)
ProGP652 (Amino acid ABC transporter substrate binding protein)
ProGP653 (Hypothetical protein)
ProGP654 (SCO1/SenC)
ProGP655 (Hypothetical protein)
ProGP656 (RNA methyltransferase)
ProGP657 (Transcriptional regulator)
ProGP658 (Hypothetical protein)
ProGP659 (Hypothetical protein)
ProGP660 (Hypothetical protein)
ProGP661 (Eight cysteine cluster domain containing protein)
ProGP662 (30S ribosomal protein S2)
ProGP663 (Protein disulfide isomerase like protein)
ProGP664 (V-type ATPase subunit D)
ProGP665 (ABC transporter)
ProGP666 (ABC transporter)
ProGP667 (V-type ATP synthase subunit E)
ProGP668 (Hypothetical protein)
ProGP669 (ABC transporter)
ProGP670 (Hypothetical protein)
ProGP671 (Hypothetical protein)
ProGP672 (Hypothetical protein)
ProGP673 (FHA domain containing protein)
ProGP674 (Hypothetical protein)
ProGP675 (Hypothetical protein)
ProGP676 (Hypothetical protein)
ProGP677 (Hypothetical protein)
ProGP678 (Hypothetical protein)
ProGP679 (Nitrate reductase alpha subunit)
ProGP680 (Peptidase S8)
ProGP681 (Formate dehydrogenase)
ProGP682 (Flagellin)
ProGP683 (Flagellin)
ProGP684 (WpaA)
ProGP685 (Cnm)
Compare ID
Choose Compare Id
ProGP1 (Envelope specific glycoprotein)
ProGP2 (Phytotoxin)
ProGP3 (S-layer glycoprotein)
ProGP4 (F-pilin)
ProGP5 (Factor PG-1)
ProGP6 (Cellulase CA)
ProGP7 (Cellulase CB)
ProGP8 (Membrane glycoprotein 152 kDa )
ProGP9 (8 kDa fimbrae)
ProGP10 (Flagellin)
ProGP11 (Autolysin (28 kDa))
ProGP12 (12 kDa antigen)
ProGP13 (33 kDa antigen)
ProGP14 (Membrane glycoprotein)
ProGP15 (N-acetylmuramoylhydrolase (Muramidase-2))
ProGP16 (50 kDa antigen)
ProGP17 (Flagellin)
ProGP18 (S-layer glycoprotein SgsE)
ProGP19 (Outer membrane protein (26.5 kDa))
ProGP20 (Outer membrane protein (50 kDa))
ProGP21 (Outer membrane protein (75 kDa))
ProGP22 (Flagellin FlaB1)
ProGP23 (Flagellin FlaB2)
ProGP24 (Flagellin FlaB3)
ProGP25 (33 and 34 kDa antigens)
ProGP26 (CenA (Endoglucanase A))
ProGP27 (Cex (Exoglucanase or xylanase))
ProGP28 (Flagellin A1)
ProGP29 (Flagellin A2)
ProGP30 (Flagellin B1)
ProGP31 (Flagellin B2)
ProGP32 (Flagellin B3)
ProGP33 (Streptococcal acid glycoprotein SAGP)
ProGP34 (S-layer glycoprotein)
ProGP35 (?-1,4-Endoglucanases)
ProGP36 (S-layer glycoprotein)
ProGP37 (S-layer glycoprotein)
ProGP38 (VGP (74 kDa))
ProGP39 (Acidic glycoproteins (133-155 kDa))
ProGP40 (Long-fibril protein (LFP))
ProGP41 (HPI (hexagonally packed intermediate) layer polypepetide)
ProGP42 (Cellobiosidase)
ProGP43 (SlgA (cell surface glycoprotein))
ProGP44 (S-layer glycoprotein)
ProGP45 (S-layer glycoprotein (94 kDa))
ProGP46 (S-layer glycoprotein (90 kDa))
ProGP47 (S-layer glycoprotein (92 kDa))
ProGP48 (S-layer glycoprotein)
ProGP49 (S-layer glycoprotein)
ProGP50 (Flagellin A)
ProGP51 (Alanine and proline-rich secreted protein Apa (50/55-kDa or 45 kDa MPT 32))
ProGP52 (Hypothetical protein)
ProGP53 (33 kDa minor core flagellin)
ProGP54 (34 kDa major core flagellin)
ProGP55 (Cell surface protein/S-layer protein)
ProGP56 (Cellulolosome complex (Cellulosomal-scaffolding protein A))
ProGP57 (38 kDa antigen)
ProGP58 (Thermopsin)
ProGP59 (?-1, 4-D-glucosidase (51 kDa))
ProGP60 (S-layer glycoprotein (118 kDa))
ProGP61 (S-layer glycoprotein (132 kDa))
ProGP62 (18 kDa and 32 kDa lectin binding proteins
ProGP63 (Xylanase B (Endo-1,4-beta-xylanase B))
ProGP64 (15 kDa-phosphate containing glycoprotein)
ProGP65 (24 kDa flagellin)
ProGP66 (25 kDa flagellin)
ProGP67 (35 kDa flagellin)
ProGP68 (S-layer glycoprotein)
ProGP69 (S-layer glycoprotein)
ProGP70 ((1,3-1,4)-beta-glucanase (MAC))
ProGP71 (S-layer glycoprotein)
ProGP72 (Alkaline Phosphatase D)
ProGP73 (p115/ PAAP)
ProGP74 (H(A107-M) (1,3-1,4)-beta-glucanase)
ProGP75 (S-layer glycoprotein)
ProGP76 (Cell surface lipoprotein MPB83 (25/23-kDa antigen))
ProGP77 (Major outer membrane protein (MOMP, 40 kD))
ProGP78 (Cell surface glycoprotein (SlgA))
ProGP79 (S-layer glycoprotein)
ProGP80 (S-layer glycoprotein (115 kDa protein))
ProGP81 (S-layer glycoprotein)
ProGP82 (Ice nucleation lipoglycoprotein)
ProGP83 (Ice nucleation lipoglycoprotein)
ProGP84 (Auracyanin-B1 (22 kDa))
ProGP85 (Auracyanin-B2 (18 kDa))
ProGP86 (Cellulase complex (230 kDa subunit))
ProGP87 (Cellulase (30 kDa) and Xylanase (15.7 kDa))
ProGP88 (S-layer glycoprotein)
ProGP89 (Surface layer glycoprotein)
ProGP90 (Antigens)
ProGP91 (S-layer glycoprotein (82 kDa))
ProGP92 (Anitigen (1000 kDa protein))
ProGP93 (Protein complex)
ProGP94 (Surface layer glycoprotein)
ProGP95 (S-layer glycoprotein)
ProGP96 (PS2 (S-layer glycoprotein))
ProGP97 (27kDa flagellin)
ProGP98 (32kDa flagellin)
ProGP99 (PilE (pilin))
ProGP100 (PF sheath protein (44 kDa))
ProGP101 (H(A16-M) (1,3-1,4)-beta-glucanase)
ProGP102 (Flagellin B1)
ProGP103 (Flagellin B2)
ProGP104 (S-layer glycoprotein (138 kDa))
ProGP105 (S-layer glycoprotein)
ProGP106 (Heparin lyase I or Heparinase I)
ProGP107 (Fimbrial protein (pilin); (group I T4P))
ProGP108 (Tetrabrachion (S layer glycoprotein))
ProGP109 (Stable protease)
ProGP110 (45 to 47-kDa protein)
ProGP111 (S-layer glycoprotein)
ProGP112 (72-kDa glycoprotein (ExsJ))
ProGP113 (Flagellin Laf1)
ProGP114 (Endo-?-N-acetylglucosaminidase F2)
ProGP115 (Flavastacin (P40))
ProGP116 (Endo-?-N-acetylglucosaminidase F3)
ProGP117 (Cell surface glycoprotein (S-layer protein))
ProGP118 (Flagellin)
ProGP119 (Fimbrial protein (pilin))
ProGP120 (Protein A (cell wall glycoprotein))
ProGP121 (Surface layer glycoprotein Sat B)
ProGP122 (Surface layer glycoprotein SatA)
ProGP123 (CRX (Copper response extracellular protein))
ProGP124 (?-1,4-mannanase)
ProGP125 (Flagellin)
ProGP126 (31/33 kDa flagellin)
ProGP127 (Flagellin B1 (41 kDa))
ProGP128 (wmA (S-layer protein))
ProGP129 (RU 41740-P1 Glyoprotein fraction (non endotoxin))
ProGP130 (Pyrolysin)
ProGP131 (Cell surface phosphatase)
ProGP132 (Chondroitinase-AC)
ProGP133 (Heparinase II)
ProGP134 (Exopolymer)
ProGP135 (37-kDa protein)
ProGP136 (Antigen (60 kDa))
ProGP137 (Oscillin (65.8 kDa))
ProGP138 (Cell surface glycoprotein)
ProGP139 (S-layer glycoprotein)
ProGP140 (?-Glucosidase (thermostable) 160 kDa)
ProGP141 (PGP)
ProGP142 (Antifreeze protein)
ProGP143 (S-layer glycoprotein (101 kDa))
ProGP144 (S-layer glycoprotein (120 kDa))
ProGP145 (Adhesion inhibitor)
ProGP146 (Flagellin)
ProGP147 (S-layer glycoprotein (29 kDa, forms tetramer))
ProGP148 (?-1,4-mannanase (G-enzyme))
ProGP149 (Crystal toxin (66 kDa))
ProGP150 (Cytochrome b558/566 subunit A (b type hemoprotein))
ProGP151 (P 110 (Adhesin-like glycoprotein 110 kDa))
ProGP152 (Type A Flagellin)
ProGP153 (Flagellin)
ProGP154 (Flagellin)
ProGP155 (Flagellin)
ProGP156 (AnAF)
ProGP157 (HBHA (heparin-binding hemagglutinin))
ProGP158 (FlaB (flagellar core protein))
ProGP159 (FlaB (flagellar core protein))
ProGP160 (Flagellar filament 31.3 kDa core protein
ProGP161 (FlaB (flagellar core protein))
ProGP162 (FlaB (flagellar core protein))
ProGP163 (FlaB (flagellar core protein))
ProGP164 (FlaB (flagellar core protein))
ProGP165 (S-layer glycopeptide)
ProGP166 (Chondroitinase-B)
ProGP167 (BclA (collagen-like protein))
ProGP168 (Slp (S-layer glycoprotein))
ProGP169 (Surface layer glycoproteins)
ProGP170 (Cysteine proteases (extracellular) Arg-gingipains (RgpA))
ProGP171 (Man26A (b-mannosidase 26A))
ProGP172 (S-layer glycoprotein)
ProGP173 (GBP (Glucose binding protein)/GlcS)
ProGP174 (Flagellin A)
ProGP175 (Flagellin B)
ProGP176 (TibA (outer membrane protein synthesized as preTibA))
ProGP177 (HRgpA)
ProGP178 (mtRgpA)
ProGP179 (S-layer glycoprotein)
ProGP180 (S-layer glycoprotein (27 kDa))
ProGP181 (P140 (140 kDa protein))
ProGP182 (P120 (120 kDa protein))
ProGP183 (GlnH)
ProGP184 (Mpt83 (Cell surface lipoprotein))
ProGP185 (Invertase)
ProGP186 (98-kDa ,58-kDa, 54-kDa glycoproteins)
ProGP187 (flaA)
ProGP188 (flaB)
ProGP189 (Superoxide dismutase [Cu-Zn])
ProGP190 (LppN lipoprotein)
ProGP191 (LppQ lipoprotein)
ProGP192 (LpqH)
ProGP193 (PstS1)
ProGP194 (PS4A (water soluble protein-polysaccharide))
ProGP195 (Streptococcal acid glycoprotein SAGP)
ProGP196 (ComP)
ProGP197 (Subtilisin (SBL)-Cys mutant)
ProGP198 (Flagellin)
ProGP199 (Flagellin)
ProGP200 (Laminin-binding glycoprotein (MS-LBP) or histone-like protein)
ProGP201 (Diffuse Adherence Adhesin (AIDA-I))
ProGP202 (TMBP (Trehalose/maltose binding protein)
ProGP203 (Cell envelope glycoprotein)
ProGP204 (CbtA (Cellobiose binding protein)
ProGP205 (Flagellin A (FlaA))
ProGP206 (Flagellin (FlaA))
ProGP207 (Glycopeptidolipid (GPL))
ProGP208 (SbsD (S-layer glycoprotein))
ProGP209 (Fap1 (Fimbrial adhesin))
ProGP210 (Protein-serine/threonine kinase (SsoPK1)
ProGP211 (TMBP (Trehalose/maltose binding protein)
ProGP212 (MDBP (Maltodextrin binding protein))
ProGP213 (95-kDa glycoprotein)
ProGP214 (Flagellin B)
ProGP215 (Flagellin A (FlaA))
ProGP216 (BclA (collagen-like protein))
ProGP217 (AcrA or CmeA)
ProGP218 (CgpA)
ProGP219 (Cj0114)
ProGP220 (Cj0200c)
ProGP221 (Cj1496c)
ProGP222 (PEB3)
ProGP223 (ZnuA)
ProGP224 (Flagellin)
ProGP225 (Flagellin)
ProGP226 (Flagellin)
ProGP227 (HMW1 (Adhesin))
ProGP228 (Short glycopeptides)
ProGP229 (GspB)
ProGP230 (PilA (Type IV pilin))
ProGP231 (VirB10 protein)
ProGP232 (Flagellin FlaA)
ProGP233 (Resuscitation promoting factor 2 (Rpf2))
ProGP234 (CipA (conserved hypothetical protein))
ProGP235 (CipB (putative dipeptide-binding protein
ProGP236 (HisJ)
ProGP237 (SgtA)
ProGP238 (FlaB1)
ProGP239 (FlaB2)
ProGP240 (FlaB3)
ProGP241 (FlaA)
ProGP242 (S-layer protein)
ProGP243 (Synthetic Glycopeptide)
ProGP244 (SrpA)
ProGP245 (SraP (serine-rich adhesin for platelets)
ProGP246 (BclB (collagen-like protein))
ProGP247 (Flagellin A)
ProGP248 (Flagellin B)
ProGP249 (Ag43? (Antigen 43 passenger domain))
ProGP250 (PilA (Pilin))
ProGP251 (Type b Flagellin)
ProGP252 (DgpA)
ProGP253 (DgpC)
ProGP254 (Dps (18 kDa), Stress inducible DNA binding protein)
ProGP255 (HmcA)
ProGP256 (CmeC)
ProGP257 (Microcystin-related protein C (MrpC))
ProGP258 (FlaB3)
ProGP259 (FlaB1)
ProGP260 (FlaB2)
ProGP261 (Flagellin (FlaA))
ProGP262 (Pillin (Group IV))
ProGP263 (Rv3491)
ProGP264 (Glycosyl hydrolase)
ProGP265 (Rv2799)
ProGP266 (LprA)
ProGP267 (GgtB)
ProGP268 (BfrB)
ProGP269 (Bglu)
ProGP270 (BlaC)
ProGP271 (FecB)
ProGP272 (LppL)
ProGP273 (LppX (Putative lipoprotein))
ProGP274 (LppZ (Putative lipoprotein))
ProGP275 (LpqB lipoprotein)
ProGP276 (LpqF lipoprotein)
ProGP277 (LpqI)
ProGP278 (LpqN)
ProGP279 (LpqT (putative lipoprotein))
ProGP280 (LpqW (lipoprotein))
ProGP281 (LprF)
ProGP282 (prG)
ProGP283 (OppA)
ProGP284 (PonA2)
ProGP285 (PpiB)
ProGP286 (PstS2)
ProGP287 (PstS3)
ProGP288 (Rv0020c)
ProGP289 (Rv0281)
ProGP290 (Rv0907)
ProGP291 (Rv0988)
ProGP292 (Rv1084)
ProGP293 (Rv2813)
ProGP294 (Secreted protease)
ProGP295 (Thioredoxin)
ProGP296 (FlaA (Flagellin))
ProGP297 (FlaB (Flagellin))
ProGP298 (FliC (Flagellin subunit))
ProGP299 (CcoP)
ProGP300 (CycB)
ProGP301 (S-layer Protein)
ProGP302 (AniA)
ProGP303 (DsbA)
ProGP304 (Gna1946)
ProGP305 (Laz)
ProGP306 (Mip (Peptidyl-prolyl cis-trans isomerase
ProGP307 (PotF)
ProGP308 (Sco)
ProGP309 (PstS (40 kDa))
ProGP310 (Hypothetical protein)
ProGP311 (BF2494)
ProGP312 (Hypothetical protein)
ProGP313 (Hypothetical protein)
ProGP314 (Putative exported protein)
ProGP315 (Putative outer membrane protein)
ProGP316 (Srr1)
ProGP317 (BF3567)
ProGP318 (BF3918)
ProGP319 (BF0935)
ProGP320 (LppC)
ProGP321 (OmpA)
ProGP322 (EtpA Adhesin)
ProGP323 (JlpA (42-45 kDa antigen))
ProGP324 (FliC (Flagellin))
ProGP325 (FliC (Flagellin))
ProGP326 (FliC (Flagellin))
ProGP327 (LccA, an Archaeal Laccase)
ProGP328 (Extracellular matrix protein adhesin A (EmaA))
ProGP329 (FTH_1830)
ProGP330 (FTH_0159)
ProGP331 (FTH_1855)
ProGP332 (FTH_0539)
ProGP333 (FTH_1112)
ProGP334 (FTH_0311)
ProGP335 (FTH_1167)
ProGP336 (FTH_1761)
ProGP337 (FTH_1721)
ProGP338 (FTH_1293)
ProGP339 (FTH_0069)
ProGP340 (FTH_1071)
ProGP341 (FTH_0414)
ProGP342 (FTH_0357)
ProGP343 (PilA (FTH_0384))
ProGP344 (SlaA (S-layer protein))
ProGP345 (Mfa1 (67 kDa minor fimbrillin))
ProGP346 (Chondroitinase ABC)
ProGP347 (Spermidine/putrescine-binding protein (PotD))
ProGP348 (TfsB (S-layer protein))
ProGP349 (TF1259)
ProGP350 (TF2339)
ProGP351 (BF0810)
ProGP352 (Putative cell division protein)
ProGP353 (Putative exported protein)
ProGP354 (Putative non-specific DNA-binding protein)
ProGP355 (Cj0017c (Disulfide bond formation protein))
ProGP356 (Cj0081 (Cytochrome bd oxidase subunit I))
ProGP357 (Putative lipoprotein)
ProGP358 (Putative membrane protein)
ProGP359 (Putative membrane protein)
ProGP360 (Cj0235c (Putative protein export protein))
ProGP361 (Putative mechanosensitive ion channel family protein)
ProGP362 (Putative sulfatase family protein)
ProGP363 (Cj0277 (Rod shape-determining protein))
ProGP364 (Putative integral membrane protein)
ProGP365 (Cj0366c (Inner membrane multidrug efflux system protein CmeB))
ProGP366 (UPF0323 lipoprotein Cj0371)
ProGP367 (Putative uncharacterized protein)
ProGP368 (Colicin V production protein)
ProGP369 (Putative membrane protein)
ProGP370 (Putative exporting protein)
ProGP371 (Putative secreted protease)
ProGP372 (Putative periplasmic protein)
ProGP373 (Putative periplasmic protein)
ProGP374 (Putative integral membrane protein)
ProGP375 (Putative OmpA family membrane protein)
ProGP376 (Putative outer membrane efflux protein)
ProGP377 (Putative periplasmic protein)
ProGP378 (Putative membrane protein)
ProGP379 (Cj0652 (Penicillin-binding protein))
ProGP380 (Putative periplasmic protein)
ProGP381 (Cj0783 (Periplasmic nitrate reductase small subunit))
ProGP382 (Putative secreted transglycosylase)
ProGP383 (Uncharacterized metallophosphoesterase)
ProGP384 (Cj0982c (Putative amino acid transporter periplasmic solute-binding protein CjaA))
ProGP385 (Cj0983 (Putative lipoprotein))
ProGP386 (Putative mechanosensitive ion channel family protein)
ProGP387 (Putative cytochrome c biogenesis protein)
ProGP388 (Cj1032 (Membrane fusion component multidrug efflux system))
ProGP389 (Putative integral membrane protein)
ProGP390 (Putative sulfatase protein)
ProGP391 (Cj1126c (Oligosaccharyltransferase))
ProGP392 (Putative periplasmic protein)
ProGP393 (Putative integral membrane protein)
ProGP394 (Cj1444c (Capsule polysaccharide export system periplasmic protein))
ProGP395 (Cj1565c (Paralyzed flagellum protein))
ProGP396 (Putative periplasmic protein)
ProGP397 (Possible ABC transport system permease)
ProGP398 (Lectin LecB)
ProGP399 (TfsA (S-layer protein))
ProGP400 (Sublancin)
ProGP401 (Plantaricin ASM1)
ProGP402 (Glycocin F)
ProGP403 (FlaA (Flagellin))
ProGP404 (FlaB (Flagellin))
ProGP405 (TF0091)
ProGP406 (TF1056)
ProGP407 (EhaJ (autotranporter))
ProGP408 (FliC (Flagellin))
ProGP409 (FliC (Flagellin))
ProGP410 (DsbA)
ProGP411 (FTL_1096)
ProGP412 (OmpA/MotB)
ProGP413 (Putative Uncharacterized Protein)
ProGP414 (Putative Uncharacterized Protein)
ProGP415 (Putative Uncharacterized Protein)
ProGP416 (Putative Uncharacterized Protein)
ProGP417 (Putative Uncharacterized Protein)
ProGP418 (Putative Uncharacterized Protein)
ProGP419 (PilA)
ProGP420 (FlaA (Polar flagellin))
ProGP421 (FlaB (Polar flagellin))
ProGP422 (LafA (Lateral flagellin))
ProGP423 (AniA)
ProGP424 (Dipeptide ABC transporter, periplasmic dipeptide binding protein (dppA))
ProGP425 (ABC Transporter (TreS))
ProGP426 (Oligopeptide binding protein)
ProGP427 (Hypothetical protein)
ProGP428 (Protease)
ProGP429 (Maltose ABC transporter)
ProGP430 (Serine protease)
ProGP431 (Hypothetical protein)
ProGP432 (Hypothetical protein)
ProGP433 (Hypothetical protein)
ProGP434 (Arabinose ABC transporter, arabinose binding protein (AraS))
ProGP435 (FasC (fasciclin domain protein))
ProGP436 (Acm2)
ProGP437 (FliC (Type B Flagellin))
ProGP438 (DnaK)
ProGP439 (Lp_2260)
ProGP440 (Lp_2162)
ProGP441 (Lp_1643)
ProGP442 (PdhC)
ProGP443 (FtsY)
ProGP444 (Lp_ 2793)
ProGP445 (FtsK1)
ProGP446 (Lp_3421)
ProGP447 (FtsZ)
ProGP448 (MOMP)
ProGP449 (PsrP (Adhesin))
ProGP450 (AtaC)
ProGP451 (COK_1394)
ProGP452 (Probable conserved proline rich membrane protein (MT2222))
ProGP453 (Probable conserved MCE associated membrane protein)
ProGP454 (Rv1887)
ProGP455 (35kDa protein)
ProGP456 (Rv3835)
ProGP457 (LppO (Putative lipoprotein))
ProGP458 (ThuA)
ProGP459 (ABC-type amino acid transport system secreted component)
ProGP460 (Putative protein)
ProGP461 (Putative uncharacterized protein)
ProGP462 (Putative uncharacterized protein)
ProGP463 (Immunogenic protein MPT63)
ProGP464 (Putative protein)
ProGP465 (Immunogenic protein MPT63)
ProGP466 (Putative protein)
ProGP467 (Alanine and proline-rich secreted protei
ProGP468 (C-terminal protease)
ProGP469 (MdtA multidrug resistance protein)
ProGP470 (Putative uncharacterized protein)
ProGP471 (Putative uncharacterized protein)
ProGP472 (Putative signal peptide)
ProGP473 (Peptidoglycan-binding membrane protein)
ProGP474 (Putative phospholipid-binding lipoprotei
ProGP475 (Putative uncharacterized protein)
ProGP476 (Putative MCE (mammalian cell entry) related protein)
ProGP477 (Putative cell division related protein)
ProGP478 (Putative uncharacterized protein)
ProGP479 (Putative lipoprotein)
ProGP480 (Putative fusaric acid resistance transporter protein)
ProGP481 (CpxP-like protein)
ProGP482 (ComEA)
ProGP483 (Putative PRC barrel containing lipoprote
ProGP484 (Putative exported protein)
ProGP485 (oprM efflux system outer membrane protein)
ProGP486 (Putative membrane protein)
ProGP487 (OM lipoprotein carrier LolA)
ProGP488 (OmlA)
ProGP489 (Cell division protein)
ProGP490 (OmpA family protein)
ProGP491 (Putative uncharacterized protein)
ProGP492 (Type IV Pilin)
ProGP493 (CN)
ProGP494 (FliC (Flagellin))
ProGP495 (EF-P)
ProGP496 (PliA)
ProGP497 (Putative secretion protein)
ProGP498 (Uncharacterized protein)
ProGP499 (Uncharacterized protein)
ProGP500 (Uncharacterized protein)
ProGP501 (Uncharacterized protein)
ProGP502 (Uncharacterized protein)
ProGP503 (Uncharacterized protein)
ProGP504 (Uncharacterized protein)
ProGP505 (Laz (lipid-modified azurin))
ProGP506 (MetQ)
ProGP507 (Sco)
ProGP508 (Mip (Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA))
ProGP509 (Ccop)
ProGP510 (Translation elongation factor P (EF-P))
ProGP511 (Translation elongation factor P (EF-P))
ProGP512 (Enterocin F4-9)
ProGP513 (Knh)
ProGP514 (EmaA)
ProGP515 (NirK)
ProGP516 (C5)
ProGP517 (CcoP)
ProGP518 (Slg1 (S-layer glycoprotein))
ProGP519 (Slg2 (S-layer glycoprotein))
ProGP520 (Hag flagellin)
ProGP521 (EF-P)
ProGP522 (Putative membrane fusion protein)
ProGP523 (Probable lipoprotein transmembrane)
ProGP524 (Probable transmembrane protein)
ProGP525 (Hypothetical signal peptide protein)
ProGP526 (RagB)
ProGP527 (Probable tpr domain signal peptide protein)
ProGP528 (FtsN)
ProGP529 (AcrA)
ProGP530 (D-(?)-3-hydroxybutyrate oligomer hydrolase)
ProGP531 (Probable transmembrane protein)
ProGP532 (Probable serine protease protein)
ProGP533 (Probable m20-related peptidase)
ProGP534 (PilN)
ProGP535 (Probable lipoprotein)
ProGP536 (Probable transmembrane protein)
ProGP537 (Peptidyl-prolyl cis-trans isomerase)
ProGP538 (Probable transmembrane protein)
ProGP539 (PilA)
ProGP540 (Probable peptidase transmembrane protein)
ProGP541 (FtsL)
ProGP542 (Translation elongation factor P (EF-P))
ProGP543 (Flagellin A1)
ProGP544 (Flagellin A2)
ProGP545 (Pilin A1)
ProGP546 (Pilin A2)
ProGP547 (Pilin A3)
ProGP548 (Pilin A4)
ProGP549 (Pilin A6)
ProGP550 (Pls (Plasmin sensitive surface protein))
ProGP551 (Pls (Plasmin sensitive surface protein))
ProGP552 (Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96)
ProGP553 (Hypothetical protein)
ProGP554 (Hypothetical protein)
ProGP555 (Hypothetical protein)
ProGP556 (Arabinase)
ProGP557 (Hypothetical protein)
ProGP558 (ABC transporter substrate binding protei
ProGP559 (Pullulanase)
ProGP560 (Hypothetical protein)
ProGP561 (Hypothetical protein)
ProGP562 (Hypothetical protein)
ProGP563 (Pullulanase)
ProGP564 (Hypothetical protein)
ProGP565 (Peptide binding protein)
ProGP566 (Multidrug RND transporter)
ProGP567 (Molybdopterin oxidoreductase)
ProGP568 (Cytochrome c biogenesis protein)
ProGP569 (Hypothetical protein)
ProGP570 (Peptide transporter)
ProGP571 (Hypothetical protein)
ProGP572 (Hypothetical protein)
ProGP573 (Hypothetical protein)
ProGP574 (Peptide transporter)
ProGP575 (Hypothetical protein)
ProGP576 (Penicillin amidase)
ProGP577 (Nitric-oxide reductase large subunit)
ProGP578 (Cytochrome c biogenesis protein)
ProGP579 (Hypothetical protein)
ProGP580 (Histidine kinase)
ProGP581 (Cytochrome c assembly)
ProGP582 (Metallophosphoesterase)
ProGP583 (ATP synthase subunit A)
ProGP584 (Hypothetical protein)
ProGP585 (Hypothetical protein)
ProGP586 (Hypothetical protein)
ProGP587 (Chloride channel protein)
ProGP588 (Hypothetical protein)
ProGP589 (Thermosome subunit)
ProGP590 (Hypothetical protein)
ProGP591 (Peptide ABC transporter substrate bindin protein)
ProGP592 (Peptidase)
ProGP593 (Hypothetical protein)
ProGP594 (ABC transporter substrate binding protei
ProGP595 (Glycosyl transferase)
ProGP596 (Nitrate reductase beta subunit)
ProGP597 (Hypothetical protein)
ProGP598 (Peptidase M50)
ProGP599 (Hypothetical protein)
ProGP600 (Hypothetical protein)
ProGP601 (Transglutaminase)
ProGP602 (FAD-dependent oxidoreductase)
ProGP603 (ABC transporter substrate binding protein)
ProGP604 (Iron ABC transporter substrate binding protein)
ProGP605 (Hypothetical protein branched chain amino acid ABC transporter substrate binding protein
ProGP606 (ABC transporter substrate binding protein)
ProGP607 (Geranylgeranyl reductase)
ProGP608 (Sugar ABC transporter substrate binding protein)
ProGP609 (Hypothetical protein)
ProGP610 (Hypothetical protein)
ProGP611 (Phosphate starvation protein PhoH)
ProGP612 (ABC transporter)
ProGP613 (Nitrous oxidase accessory protein)
ProGP614 (Glutamate dehydrogenase)
ProGP615 (Hypothetical protein)
ProGP616 (NADH dehydrogenase subunit D)
ProGP617 (Nodulation efficiency protein NfeD)
ProGP618 (Hypothetical protein)
ProGP619 (Hypothetical protein)
ProGP620 (Hypothetical protein)
ProGP621 (Sugar binding protein)
ProGP622 (NADH-ubiquinone oxidoreductase)
ProGP623 (Hypothetical protein)
ProGP624 (Branched chain amino acid ABC transporter substrate binding protein)
ProGP625 (Hypothetical protein)
ProGP626 (Serpin)
ProGP627 (Hypothetical protein)
ProGP628 (ABC transporter substrate binding protein)
ProGP629 (ATPase)
ProGP630 (Hypothetical protein)
ProGP631 (ABC transporter)
ProGP632 (ABC transporter substrate binding protein)
ProGP633 (Hypothetical protein)
ProGP634 (Peptide ABC transporter permease)
ProGP635 (TRAP ABC transporter)
ProGP636 (NosD)
ProGP637 (Cytochrome c biogenesis protein)
ProGP638 (Excisionase)
ProGP639 (ABC transporter periplasmic binding protein)
ProGP640 (Primosomal protein)
ProGP641 (Hypothetical protein)
ProGP642 (Cytochrome c assembly protein)
ProGP643 (Glycosyltransferase)
ProGP644 (Hypothetical protein)
ProGP645 (ABC transporter substrate binding protein)
ProGP646 (Glycosyltransferase)
ProGP647 (Hypothetical protein)
ProGP648 (Nitrate reductase)
ProGP649 (Transcriptional regulator)
ProGP650 (Hypothetical protein)
ProGP651 (4Fe-4S ferredoxin)
ProGP652 (Amino acid ABC transporter substrate binding protein)
ProGP653 (Hypothetical protein)
ProGP654 (SCO1/SenC)
ProGP655 (Hypothetical protein)
ProGP656 (RNA methyltransferase)
ProGP657 (Transcriptional regulator)
ProGP658 (Hypothetical protein)
ProGP659 (Hypothetical protein)
ProGP660 (Hypothetical protein)
ProGP661 (Eight cysteine cluster domain containing protein)
ProGP662 (30S ribosomal protein S2)
ProGP663 (Protein disulfide isomerase like protein)
ProGP664 (V-type ATPase subunit D)
ProGP665 (ABC transporter)
ProGP666 (ABC transporter)
ProGP667 (V-type ATP synthase subunit E)
ProGP668 (Hypothetical protein)
ProGP669 (ABC transporter)
ProGP670 (Hypothetical protein)
ProGP671 (Hypothetical protein)
ProGP672 (Hypothetical protein)
ProGP673 (FHA domain containing protein)
ProGP674 (Hypothetical protein)
ProGP675 (Hypothetical protein)
ProGP676 (Hypothetical protein)
ProGP677 (Hypothetical protein)
ProGP678 (Hypothetical protein)
ProGP679 (Nitrate reductase alpha subunit)
ProGP680 (Peptidase S8)
ProGP681 (Formate dehydrogenase)
ProGP682 (Flagellin)
ProGP683 (Flagellin)
ProGP684 (WpaA)
ProGP685 (Cnm)
Compare ID
Choose Compare Id
ProGP1 (Envelope specific glycoprotein)
ProGP2 (Phytotoxin)
ProGP3 (S-layer glycoprotein)
ProGP4 (F-pilin)
ProGP5 (Factor PG-1)
ProGP6 (Cellulase CA)
ProGP7 (Cellulase CB)
ProGP8 (Membrane glycoprotein 152 kDa )
ProGP9 (8 kDa fimbrae)
ProGP10 (Flagellin)
ProGP11 (Autolysin (28 kDa))
ProGP12 (12 kDa antigen)
ProGP13 (33 kDa antigen)
ProGP14 (Membrane glycoprotein)
ProGP15 (N-acetylmuramoylhydrolase (Muramidase-2))
ProGP16 (50 kDa antigen)
ProGP17 (Flagellin)
ProGP18 (S-layer glycoprotein SgsE)
ProGP19 (Outer membrane protein (26.5 kDa))
ProGP20 (Outer membrane protein (50 kDa))
ProGP21 (Outer membrane protein (75 kDa))
ProGP22 (Flagellin FlaB1)
ProGP23 (Flagellin FlaB2)
ProGP24 (Flagellin FlaB3)
ProGP25 (33 and 34 kDa antigens)
ProGP26 (CenA (Endoglucanase A))
ProGP27 (Cex (Exoglucanase or xylanase))
ProGP28 (Flagellin A1)
ProGP29 (Flagellin A2)
ProGP30 (Flagellin B1)
ProGP31 (Flagellin B2)
ProGP32 (Flagellin B3)
ProGP33 (Streptococcal acid glycoprotein SAGP)
ProGP34 (S-layer glycoprotein)
ProGP35 (?-1,4-Endoglucanases)
ProGP36 (S-layer glycoprotein)
ProGP37 (S-layer glycoprotein)
ProGP38 (VGP (74 kDa))
ProGP39 (Acidic glycoproteins (133-155 kDa))
ProGP40 (Long-fibril protein (LFP))
ProGP41 (HPI (hexagonally packed intermediate) layer polypepetide)
ProGP42 (Cellobiosidase)
ProGP43 (SlgA (cell surface glycoprotein))
ProGP44 (S-layer glycoprotein)
ProGP45 (S-layer glycoprotein (94 kDa))
ProGP46 (S-layer glycoprotein (90 kDa))
ProGP47 (S-layer glycoprotein (92 kDa))
ProGP48 (S-layer glycoprotein)
ProGP49 (S-layer glycoprotein)
ProGP50 (Flagellin A)
ProGP51 (Alanine and proline-rich secreted protein Apa (50/55-kDa or 45 kDa MPT 32))
ProGP52 (Hypothetical protein)
ProGP53 (33 kDa minor core flagellin)
ProGP54 (34 kDa major core flagellin)
ProGP55 (Cell surface protein/S-layer protein)
ProGP56 (Cellulolosome complex (Cellulosomal-scaffolding protein A))
ProGP57 (38 kDa antigen)
ProGP58 (Thermopsin)
ProGP59 (?-1, 4-D-glucosidase (51 kDa))
ProGP60 (S-layer glycoprotein (118 kDa))
ProGP61 (S-layer glycoprotein (132 kDa))
ProGP62 (18 kDa and 32 kDa lectin binding proteins
ProGP63 (Xylanase B (Endo-1,4-beta-xylanase B))
ProGP64 (15 kDa-phosphate containing glycoprotein)
ProGP65 (24 kDa flagellin)
ProGP66 (25 kDa flagellin)
ProGP67 (35 kDa flagellin)
ProGP68 (S-layer glycoprotein)
ProGP69 (S-layer glycoprotein)
ProGP70 ((1,3-1,4)-beta-glucanase (MAC))
ProGP71 (S-layer glycoprotein)
ProGP72 (Alkaline Phosphatase D)
ProGP73 (p115/ PAAP)
ProGP74 (H(A107-M) (1,3-1,4)-beta-glucanase)
ProGP75 (S-layer glycoprotein)
ProGP76 (Cell surface lipoprotein MPB83 (25/23-kDa antigen))
ProGP77 (Major outer membrane protein (MOMP, 40 kD))
ProGP78 (Cell surface glycoprotein (SlgA))
ProGP79 (S-layer glycoprotein)
ProGP80 (S-layer glycoprotein (115 kDa protein))
ProGP81 (S-layer glycoprotein)
ProGP82 (Ice nucleation lipoglycoprotein)
ProGP83 (Ice nucleation lipoglycoprotein)
ProGP84 (Auracyanin-B1 (22 kDa))
ProGP85 (Auracyanin-B2 (18 kDa))
ProGP86 (Cellulase complex (230 kDa subunit))
ProGP87 (Cellulase (30 kDa) and Xylanase (15.7 kDa))
ProGP88 (S-layer glycoprotein)
ProGP89 (Surface layer glycoprotein)
ProGP90 (Antigens)
ProGP91 (S-layer glycoprotein (82 kDa))
ProGP92 (Anitigen (1000 kDa protein))
ProGP93 (Protein complex)
ProGP94 (Surface layer glycoprotein)
ProGP95 (S-layer glycoprotein)
ProGP96 (PS2 (S-layer glycoprotein))
ProGP97 (27kDa flagellin)
ProGP98 (32kDa flagellin)
ProGP99 (PilE (pilin))
ProGP100 (PF sheath protein (44 kDa))
ProGP101 (H(A16-M) (1,3-1,4)-beta-glucanase)
ProGP102 (Flagellin B1)
ProGP103 (Flagellin B2)
ProGP104 (S-layer glycoprotein (138 kDa))
ProGP105 (S-layer glycoprotein)
ProGP106 (Heparin lyase I or Heparinase I)
ProGP107 (Fimbrial protein (pilin); (group I T4P))
ProGP108 (Tetrabrachion (S layer glycoprotein))
ProGP109 (Stable protease)
ProGP110 (45 to 47-kDa protein)
ProGP111 (S-layer glycoprotein)
ProGP112 (72-kDa glycoprotein (ExsJ))
ProGP113 (Flagellin Laf1)
ProGP114 (Endo-?-N-acetylglucosaminidase F2)
ProGP115 (Flavastacin (P40))
ProGP116 (Endo-?-N-acetylglucosaminidase F3)
ProGP117 (Cell surface glycoprotein (S-layer protein))
ProGP118 (Flagellin)
ProGP119 (Fimbrial protein (pilin))
ProGP120 (Protein A (cell wall glycoprotein))
ProGP121 (Surface layer glycoprotein Sat B)
ProGP122 (Surface layer glycoprotein SatA)
ProGP123 (CRX (Copper response extracellular protein))
ProGP124 (?-1,4-mannanase)
ProGP125 (Flagellin)
ProGP126 (31/33 kDa flagellin)
ProGP127 (Flagellin B1 (41 kDa))
ProGP128 (wmA (S-layer protein))
ProGP129 (RU 41740-P1 Glyoprotein fraction (non endotoxin))
ProGP130 (Pyrolysin)
ProGP131 (Cell surface phosphatase)
ProGP132 (Chondroitinase-AC)
ProGP133 (Heparinase II)
ProGP134 (Exopolymer)
ProGP135 (37-kDa protein)
ProGP136 (Antigen (60 kDa))
ProGP137 (Oscillin (65.8 kDa))
ProGP138 (Cell surface glycoprotein)
ProGP139 (S-layer glycoprotein)
ProGP140 (?-Glucosidase (thermostable) 160 kDa)
ProGP141 (PGP)
ProGP142 (Antifreeze protein)
ProGP143 (S-layer glycoprotein (101 kDa))
ProGP144 (S-layer glycoprotein (120 kDa))
ProGP145 (Adhesion inhibitor)
ProGP146 (Flagellin)
ProGP147 (S-layer glycoprotein (29 kDa, forms tetramer))
ProGP148 (?-1,4-mannanase (G-enzyme))
ProGP149 (Crystal toxin (66 kDa))
ProGP150 (Cytochrome b558/566 subunit A (b type hemoprotein))
ProGP151 (P 110 (Adhesin-like glycoprotein 110 kDa))
ProGP152 (Type A Flagellin)
ProGP153 (Flagellin)
ProGP154 (Flagellin)
ProGP155 (Flagellin)
ProGP156 (AnAF)
ProGP157 (HBHA (heparin-binding hemagglutinin))
ProGP158 (FlaB (flagellar core protein))
ProGP159 (FlaB (flagellar core protein))
ProGP160 (Flagellar filament 31.3 kDa core protein
ProGP161 (FlaB (flagellar core protein))
ProGP162 (FlaB (flagellar core protein))
ProGP163 (FlaB (flagellar core protein))
ProGP164 (FlaB (flagellar core protein))
ProGP165 (S-layer glycopeptide)
ProGP166 (Chondroitinase-B)
ProGP167 (BclA (collagen-like protein))
ProGP168 (Slp (S-layer glycoprotein))
ProGP169 (Surface layer glycoproteins)
ProGP170 (Cysteine proteases (extracellular) Arg-gingipains (RgpA))
ProGP171 (Man26A (b-mannosidase 26A))
ProGP172 (S-layer glycoprotein)
ProGP173 (GBP (Glucose binding protein)/GlcS)
ProGP174 (Flagellin A)
ProGP175 (Flagellin B)
ProGP176 (TibA (outer membrane protein synthesized as preTibA))
ProGP177 (HRgpA)
ProGP178 (mtRgpA)
ProGP179 (S-layer glycoprotein)
ProGP180 (S-layer glycoprotein (27 kDa))
ProGP181 (P140 (140 kDa protein))
ProGP182 (P120 (120 kDa protein))
ProGP183 (GlnH)
ProGP184 (Mpt83 (Cell surface lipoprotein))
ProGP185 (Invertase)
ProGP186 (98-kDa ,58-kDa, 54-kDa glycoproteins)
ProGP187 (flaA)
ProGP188 (flaB)
ProGP189 (Superoxide dismutase [Cu-Zn])
ProGP190 (LppN lipoprotein)
ProGP191 (LppQ lipoprotein)
ProGP192 (LpqH)
ProGP193 (PstS1)
ProGP194 (PS4A (water soluble protein-polysaccharide))
ProGP195 (Streptococcal acid glycoprotein SAGP)
ProGP196 (ComP)
ProGP197 (Subtilisin (SBL)-Cys mutant)
ProGP198 (Flagellin)
ProGP199 (Flagellin)
ProGP200 (Laminin-binding glycoprotein (MS-LBP) or histone-like protein)
ProGP201 (Diffuse Adherence Adhesin (AIDA-I))
ProGP202 (TMBP (Trehalose/maltose binding protein)
ProGP203 (Cell envelope glycoprotein)
ProGP204 (CbtA (Cellobiose binding protein)
ProGP205 (Flagellin A (FlaA))
ProGP206 (Flagellin (FlaA))
ProGP207 (Glycopeptidolipid (GPL))
ProGP208 (SbsD (S-layer glycoprotein))
ProGP209 (Fap1 (Fimbrial adhesin))
ProGP210 (Protein-serine/threonine kinase (SsoPK1)
ProGP211 (TMBP (Trehalose/maltose binding protein)
ProGP212 (MDBP (Maltodextrin binding protein))
ProGP213 (95-kDa glycoprotein)
ProGP214 (Flagellin B)
ProGP215 (Flagellin A (FlaA))
ProGP216 (BclA (collagen-like protein))
ProGP217 (AcrA or CmeA)
ProGP218 (CgpA)
ProGP219 (Cj0114)
ProGP220 (Cj0200c)
ProGP221 (Cj1496c)
ProGP222 (PEB3)
ProGP223 (ZnuA)
ProGP224 (Flagellin)
ProGP225 (Flagellin)
ProGP226 (Flagellin)
ProGP227 (HMW1 (Adhesin))
ProGP228 (Short glycopeptides)
ProGP229 (GspB)
ProGP230 (PilA (Type IV pilin))
ProGP231 (VirB10 protein)
ProGP232 (Flagellin FlaA)
ProGP233 (Resuscitation promoting factor 2 (Rpf2))
ProGP234 (CipA (conserved hypothetical protein))
ProGP235 (CipB (putative dipeptide-binding protein
ProGP236 (HisJ)
ProGP237 (SgtA)
ProGP238 (FlaB1)
ProGP239 (FlaB2)
ProGP240 (FlaB3)
ProGP241 (FlaA)
ProGP242 (S-layer protein)
ProGP243 (Synthetic Glycopeptide)
ProGP244 (SrpA)
ProGP245 (SraP (serine-rich adhesin for platelets)
ProGP246 (BclB (collagen-like protein))
ProGP247 (Flagellin A)
ProGP248 (Flagellin B)
ProGP249 (Ag43? (Antigen 43 passenger domain))
ProGP250 (PilA (Pilin))
ProGP251 (Type b Flagellin)
ProGP252 (DgpA)
ProGP253 (DgpC)
ProGP254 (Dps (18 kDa), Stress inducible DNA binding protein)
ProGP255 (HmcA)
ProGP256 (CmeC)
ProGP257 (Microcystin-related protein C (MrpC))
ProGP258 (FlaB3)
ProGP259 (FlaB1)
ProGP260 (FlaB2)
ProGP261 (Flagellin (FlaA))
ProGP262 (Pillin (Group IV))
ProGP263 (Rv3491)
ProGP264 (Glycosyl hydrolase)
ProGP265 (Rv2799)
ProGP266 (LprA)
ProGP267 (GgtB)
ProGP268 (BfrB)
ProGP269 (Bglu)
ProGP270 (BlaC)
ProGP271 (FecB)
ProGP272 (LppL)
ProGP273 (LppX (Putative lipoprotein))
ProGP274 (LppZ (Putative lipoprotein))
ProGP275 (LpqB lipoprotein)
ProGP276 (LpqF lipoprotein)
ProGP277 (LpqI)
ProGP278 (LpqN)
ProGP279 (LpqT (putative lipoprotein))
ProGP280 (LpqW (lipoprotein))
ProGP281 (LprF)
ProGP282 (prG)
ProGP283 (OppA)
ProGP284 (PonA2)
ProGP285 (PpiB)
ProGP286 (PstS2)
ProGP287 (PstS3)
ProGP288 (Rv0020c)
ProGP289 (Rv0281)
ProGP290 (Rv0907)
ProGP291 (Rv0988)
ProGP292 (Rv1084)
ProGP293 (Rv2813)
ProGP294 (Secreted protease)
ProGP295 (Thioredoxin)
ProGP296 (FlaA (Flagellin))
ProGP297 (FlaB (Flagellin))
ProGP298 (FliC (Flagellin subunit))
ProGP299 (CcoP)
ProGP300 (CycB)
ProGP301 (S-layer Protein)
ProGP302 (AniA)
ProGP303 (DsbA)
ProGP304 (Gna1946)
ProGP305 (Laz)
ProGP306 (Mip (Peptidyl-prolyl cis-trans isomerase
ProGP307 (PotF)
ProGP308 (Sco)
ProGP309 (PstS (40 kDa))
ProGP310 (Hypothetical protein)
ProGP311 (BF2494)
ProGP312 (Hypothetical protein)
ProGP313 (Hypothetical protein)
ProGP314 (Putative exported protein)
ProGP315 (Putative outer membrane protein)
ProGP316 (Srr1)
ProGP317 (BF3567)
ProGP318 (BF3918)
ProGP319 (BF0935)
ProGP320 (LppC)
ProGP321 (OmpA)
ProGP322 (EtpA Adhesin)
ProGP323 (JlpA (42-45 kDa antigen))
ProGP324 (FliC (Flagellin))
ProGP325 (FliC (Flagellin))
ProGP326 (FliC (Flagellin))
ProGP327 (LccA, an Archaeal Laccase)
ProGP328 (Extracellular matrix protein adhesin A (EmaA))
ProGP329 (FTH_1830)
ProGP330 (FTH_0159)
ProGP331 (FTH_1855)
ProGP332 (FTH_0539)
ProGP333 (FTH_1112)
ProGP334 (FTH_0311)
ProGP335 (FTH_1167)
ProGP336 (FTH_1761)
ProGP337 (FTH_1721)
ProGP338 (FTH_1293)
ProGP339 (FTH_0069)
ProGP340 (FTH_1071)
ProGP341 (FTH_0414)
ProGP342 (FTH_0357)
ProGP343 (PilA (FTH_0384))
ProGP344 (SlaA (S-layer protein))
ProGP345 (Mfa1 (67 kDa minor fimbrillin))
ProGP346 (Chondroitinase ABC)
ProGP347 (Spermidine/putrescine-binding protein (PotD))
ProGP348 (TfsB (S-layer protein))
ProGP349 (TF1259)
ProGP350 (TF2339)
ProGP351 (BF0810)
ProGP352 (Putative cell division protein)
ProGP353 (Putative exported protein)
ProGP354 (Putative non-specific DNA-binding protein)
ProGP355 (Cj0017c (Disulfide bond formation protein))
ProGP356 (Cj0081 (Cytochrome bd oxidase subunit I))
ProGP357 (Putative lipoprotein)
ProGP358 (Putative membrane protein)
ProGP359 (Putative membrane protein)
ProGP360 (Cj0235c (Putative protein export protein))
ProGP361 (Putative mechanosensitive ion channel family protein)
ProGP362 (Putative sulfatase family protein)
ProGP363 (Cj0277 (Rod shape-determining protein))
ProGP364 (Putative integral membrane protein)
ProGP365 (Cj0366c (Inner membrane multidrug efflux system protein CmeB))
ProGP366 (UPF0323 lipoprotein Cj0371)
ProGP367 (Putative uncharacterized protein)
ProGP368 (Colicin V production protein)
ProGP369 (Putative membrane protein)
ProGP370 (Putative exporting protein)
ProGP371 (Putative secreted protease)
ProGP372 (Putative periplasmic protein)
ProGP373 (Putative periplasmic protein)
ProGP374 (Putative integral membrane protein)
ProGP375 (Putative OmpA family membrane protein)
ProGP376 (Putative outer membrane efflux protein)
ProGP377 (Putative periplasmic protein)
ProGP378 (Putative membrane protein)
ProGP379 (Cj0652 (Penicillin-binding protein))
ProGP380 (Putative periplasmic protein)
ProGP381 (Cj0783 (Periplasmic nitrate reductase small subunit))
ProGP382 (Putative secreted transglycosylase)
ProGP383 (Uncharacterized metallophosphoesterase)
ProGP384 (Cj0982c (Putative amino acid transporter periplasmic solute-binding protein CjaA))
ProGP385 (Cj0983 (Putative lipoprotein))
ProGP386 (Putative mechanosensitive ion channel family protein)
ProGP387 (Putative cytochrome c biogenesis protein)
ProGP388 (Cj1032 (Membrane fusion component multidrug efflux system))
ProGP389 (Putative integral membrane protein)
ProGP390 (Putative sulfatase protein)
ProGP391 (Cj1126c (Oligosaccharyltransferase))
ProGP392 (Putative periplasmic protein)
ProGP393 (Putative integral membrane protein)
ProGP394 (Cj1444c (Capsule polysaccharide export system periplasmic protein))
ProGP395 (Cj1565c (Paralyzed flagellum protein))
ProGP396 (Putative periplasmic protein)
ProGP397 (Possible ABC transport system permease)
ProGP398 (Lectin LecB)
ProGP399 (TfsA (S-layer protein))
ProGP400 (Sublancin)
ProGP401 (Plantaricin ASM1)
ProGP402 (Glycocin F)
ProGP403 (FlaA (Flagellin))
ProGP404 (FlaB (Flagellin))
ProGP405 (TF0091)
ProGP406 (TF1056)
ProGP407 (EhaJ (autotranporter))
ProGP408 (FliC (Flagellin))
ProGP409 (FliC (Flagellin))
ProGP410 (DsbA)
ProGP411 (FTL_1096)
ProGP412 (OmpA/MotB)
ProGP413 (Putative Uncharacterized Protein)
ProGP414 (Putative Uncharacterized Protein)
ProGP415 (Putative Uncharacterized Protein)
ProGP416 (Putative Uncharacterized Protein)
ProGP417 (Putative Uncharacterized Protein)
ProGP418 (Putative Uncharacterized Protein)
ProGP419 (PilA)
ProGP420 (FlaA (Polar flagellin))
ProGP421 (FlaB (Polar flagellin))
ProGP422 (LafA (Lateral flagellin))
ProGP423 (AniA)
ProGP424 (Dipeptide ABC transporter, periplasmic dipeptide binding protein (dppA))
ProGP425 (ABC Transporter (TreS))
ProGP426 (Oligopeptide binding protein)
ProGP427 (Hypothetical protein)
ProGP428 (Protease)
ProGP429 (Maltose ABC transporter)
ProGP430 (Serine protease)
ProGP431 (Hypothetical protein)
ProGP432 (Hypothetical protein)
ProGP433 (Hypothetical protein)
ProGP434 (Arabinose ABC transporter, arabinose binding protein (AraS))
ProGP435 (FasC (fasciclin domain protein))
ProGP436 (Acm2)
ProGP437 (FliC (Type B Flagellin))
ProGP438 (DnaK)
ProGP439 (Lp_2260)
ProGP440 (Lp_2162)
ProGP441 (Lp_1643)
ProGP442 (PdhC)
ProGP443 (FtsY)
ProGP444 (Lp_ 2793)
ProGP445 (FtsK1)
ProGP446 (Lp_3421)
ProGP447 (FtsZ)
ProGP448 (MOMP)
ProGP449 (PsrP (Adhesin))
ProGP450 (AtaC)
ProGP451 (COK_1394)
ProGP452 (Probable conserved proline rich membrane protein (MT2222))
ProGP453 (Probable conserved MCE associated membrane protein)
ProGP454 (Rv1887)
ProGP455 (35kDa protein)
ProGP456 (Rv3835)
ProGP457 (LppO (Putative lipoprotein))
ProGP458 (ThuA)
ProGP459 (ABC-type amino acid transport system secreted component)
ProGP460 (Putative protein)
ProGP461 (Putative uncharacterized protein)
ProGP462 (Putative uncharacterized protein)
ProGP463 (Immunogenic protein MPT63)
ProGP464 (Putative protein)
ProGP465 (Immunogenic protein MPT63)
ProGP466 (Putative protein)
ProGP467 (Alanine and proline-rich secreted protei
ProGP468 (C-terminal protease)
ProGP469 (MdtA multidrug resistance protein)
ProGP470 (Putative uncharacterized protein)
ProGP471 (Putative uncharacterized protein)
ProGP472 (Putative signal peptide)
ProGP473 (Peptidoglycan-binding membrane protein)
ProGP474 (Putative phospholipid-binding lipoprotei
ProGP475 (Putative uncharacterized protein)
ProGP476 (Putative MCE (mammalian cell entry) related protein)
ProGP477 (Putative cell division related protein)
ProGP478 (Putative uncharacterized protein)
ProGP479 (Putative lipoprotein)
ProGP480 (Putative fusaric acid resistance transporter protein)
ProGP481 (CpxP-like protein)
ProGP482 (ComEA)
ProGP483 (Putative PRC barrel containing lipoprote
ProGP484 (Putative exported protein)
ProGP485 (oprM efflux system outer membrane protein)
ProGP486 (Putative membrane protein)
ProGP487 (OM lipoprotein carrier LolA)
ProGP488 (OmlA)
ProGP489 (Cell division protein)
ProGP490 (OmpA family protein)
ProGP491 (Putative uncharacterized protein)
ProGP492 (Type IV Pilin)
ProGP493 (CN)
ProGP494 (FliC (Flagellin))
ProGP495 (EF-P)
ProGP496 (PliA)
ProGP497 (Putative secretion protein)
ProGP498 (Uncharacterized protein)
ProGP499 (Uncharacterized protein)
ProGP500 (Uncharacterized protein)
ProGP501 (Uncharacterized protein)
ProGP502 (Uncharacterized protein)
ProGP503 (Uncharacterized protein)
ProGP504 (Uncharacterized protein)
ProGP505 (Laz (lipid-modified azurin))
ProGP506 (MetQ)
ProGP507 (Sco)
ProGP508 (Mip (Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA))
ProGP509 (Ccop)
ProGP510 (Translation elongation factor P (EF-P))
ProGP511 (Translation elongation factor P (EF-P))
ProGP512 (Enterocin F4-9)
ProGP513 (Knh)
ProGP514 (EmaA)
ProGP515 (NirK)
ProGP516 (C5)
ProGP517 (CcoP)
ProGP518 (Slg1 (S-layer glycoprotein))
ProGP519 (Slg2 (S-layer glycoprotein))
ProGP520 (Hag flagellin)
ProGP521 (EF-P)
ProGP522 (Putative membrane fusion protein)
ProGP523 (Probable lipoprotein transmembrane)
ProGP524 (Probable transmembrane protein)
ProGP525 (Hypothetical signal peptide protein)
ProGP526 (RagB)
ProGP527 (Probable tpr domain signal peptide protein)
ProGP528 (FtsN)
ProGP529 (AcrA)
ProGP530 (D-(?)-3-hydroxybutyrate oligomer hydrolase)
ProGP531 (Probable transmembrane protein)
ProGP532 (Probable serine protease protein)
ProGP533 (Probable m20-related peptidase)
ProGP534 (PilN)
ProGP535 (Probable lipoprotein)
ProGP536 (Probable transmembrane protein)
ProGP537 (Peptidyl-prolyl cis-trans isomerase)
ProGP538 (Probable transmembrane protein)
ProGP539 (PilA)
ProGP540 (Probable peptidase transmembrane protein)
ProGP541 (FtsL)
ProGP542 (Translation elongation factor P (EF-P))
ProGP543 (Flagellin A1)
ProGP544 (Flagellin A2)
ProGP545 (Pilin A1)
ProGP546 (Pilin A2)
ProGP547 (Pilin A3)
ProGP548 (Pilin A4)
ProGP549 (Pilin A6)
ProGP550 (Pls (Plasmin sensitive surface protein))
ProGP551 (Pls (Plasmin sensitive surface protein))
ProGP552 (Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96)
ProGP553 (Hypothetical protein)
ProGP554 (Hypothetical protein)
ProGP555 (Hypothetical protein)
ProGP556 (Arabinase)
ProGP557 (Hypothetical protein)
ProGP558 (ABC transporter substrate binding protei
ProGP559 (Pullulanase)
ProGP560 (Hypothetical protein)
ProGP561 (Hypothetical protein)
ProGP562 (Hypothetical protein)
ProGP563 (Pullulanase)
ProGP564 (Hypothetical protein)
ProGP565 (Peptide binding protein)
ProGP566 (Multidrug RND transporter)
ProGP567 (Molybdopterin oxidoreductase)
ProGP568 (Cytochrome c biogenesis protein)
ProGP569 (Hypothetical protein)
ProGP570 (Peptide transporter)
ProGP571 (Hypothetical protein)
ProGP572 (Hypothetical protein)
ProGP573 (Hypothetical protein)
ProGP574 (Peptide transporter)
ProGP575 (Hypothetical protein)
ProGP576 (Penicillin amidase)
ProGP577 (Nitric-oxide reductase large subunit)
ProGP578 (Cytochrome c biogenesis protein)
ProGP579 (Hypothetical protein)
ProGP580 (Histidine kinase)
ProGP581 (Cytochrome c assembly)
ProGP582 (Metallophosphoesterase)
ProGP583 (ATP synthase subunit A)
ProGP584 (Hypothetical protein)
ProGP585 (Hypothetical protein)
ProGP586 (Hypothetical protein)
ProGP587 (Chloride channel protein)
ProGP588 (Hypothetical protein)
ProGP589 (Thermosome subunit)
ProGP590 (Hypothetical protein)
ProGP591 (Peptide ABC transporter substrate bindin protein)
ProGP592 (Peptidase)
ProGP593 (Hypothetical protein)
ProGP594 (ABC transporter substrate binding protei
ProGP595 (Glycosyl transferase)
ProGP596 (Nitrate reductase beta subunit)
ProGP597 (Hypothetical protein)
ProGP598 (Peptidase M50)
ProGP599 (Hypothetical protein)
ProGP600 (Hypothetical protein)
ProGP601 (Transglutaminase)
ProGP602 (FAD-dependent oxidoreductase)
ProGP603 (ABC transporter substrate binding protein)
ProGP604 (Iron ABC transporter substrate binding protein)
ProGP605 (Hypothetical protein branched chain amino acid ABC transporter substrate binding protein
ProGP606 (ABC transporter substrate binding protein)
ProGP607 (Geranylgeranyl reductase)
ProGP608 (Sugar ABC transporter substrate binding protein)
ProGP609 (Hypothetical protein)
ProGP610 (Hypothetical protein)
ProGP611 (Phosphate starvation protein PhoH)
ProGP612 (ABC transporter)
ProGP613 (Nitrous oxidase accessory protein)
ProGP614 (Glutamate dehydrogenase)
ProGP615 (Hypothetical protein)
ProGP616 (NADH dehydrogenase subunit D)
ProGP617 (Nodulation efficiency protein NfeD)
ProGP618 (Hypothetical protein)
ProGP619 (Hypothetical protein)
ProGP620 (Hypothetical protein)
ProGP621 (Sugar binding protein)
ProGP622 (NADH-ubiquinone oxidoreductase)
ProGP623 (Hypothetical protein)
ProGP624 (Branched chain amino acid ABC transporter substrate binding protein)
ProGP625 (Hypothetical protein)
ProGP626 (Serpin)
ProGP627 (Hypothetical protein)
ProGP628 (ABC transporter substrate binding protein)
ProGP629 (ATPase)
ProGP630 (Hypothetical protein)
ProGP631 (ABC transporter)
ProGP632 (ABC transporter substrate binding protein)
ProGP633 (Hypothetical protein)
ProGP634 (Peptide ABC transporter permease)
ProGP635 (TRAP ABC transporter)
ProGP636 (NosD)
ProGP637 (Cytochrome c biogenesis protein)
ProGP638 (Excisionase)
ProGP639 (ABC transporter periplasmic binding protein)
ProGP640 (Primosomal protein)
ProGP641 (Hypothetical protein)
ProGP642 (Cytochrome c assembly protein)
ProGP643 (Glycosyltransferase)
ProGP644 (Hypothetical protein)
ProGP645 (ABC transporter substrate binding protein)
ProGP646 (Glycosyltransferase)
ProGP647 (Hypothetical protein)
ProGP648 (Nitrate reductase)
ProGP649 (Transcriptional regulator)
ProGP650 (Hypothetical protein)
ProGP651 (4Fe-4S ferredoxin)
ProGP652 (Amino acid ABC transporter substrate binding protein)
ProGP653 (Hypothetical protein)
ProGP654 (SCO1/SenC)
ProGP655 (Hypothetical protein)
ProGP656 (RNA methyltransferase)
ProGP657 (Transcriptional regulator)
ProGP658 (Hypothetical protein)
ProGP659 (Hypothetical protein)
ProGP660 (Hypothetical protein)
ProGP661 (Eight cysteine cluster domain containing protein)
ProGP662 (30S ribosomal protein S2)
ProGP663 (Protein disulfide isomerase like protein)
ProGP664 (V-type ATPase subunit D)
ProGP665 (ABC transporter)
ProGP666 (ABC transporter)
ProGP667 (V-type ATP synthase subunit E)
ProGP668 (Hypothetical protein)
ProGP669 (ABC transporter)
ProGP670 (Hypothetical protein)
ProGP671 (Hypothetical protein)
ProGP672 (Hypothetical protein)
ProGP673 (FHA domain containing protein)
ProGP674 (Hypothetical protein)
ProGP675 (Hypothetical protein)
ProGP676 (Hypothetical protein)
ProGP677 (Hypothetical protein)
ProGP678 (Hypothetical protein)
ProGP679 (Nitrate reductase alpha subunit)
ProGP680 (Peptidase S8)
ProGP681 (Formate dehydrogenase)
ProGP682 (Flagellin)
ProGP683 (Flagellin)
ProGP684 (WpaA)
ProGP685 (Cnm)
Search Display Criteria
all
Organism
Gene Information
Genome Information
Protein Information
Protein Structure
Glycosylation Status
Glycan Information
Protein Glycosylation linked (PGL) gene(s)
Accessory PGL Gene(s)
Literature
ProGP ID
ProGP436 (Acm2)
Validation Status
Characterized
Organism Information
Organism Name
Lactobacillus plantarum
Domain
Bacteria
Classification
Family: Lactobacillaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)
220668
Genome Information
GenBank
NC_004567.2.
EMBL
AL935263
Gene Information
Gene Name
acm2
GenBank Gene Sequence
NC_004567.2.
Protein Information
Protein Name
Acm2
UniProtKB/SwissProt ID
F9URD9
NCBI RefSeq
WP_011101863.1.
EMBL-CDS
CCC79778.1.
UniProtKB Sequence
>tr|F9URD9|F9URD9_LACPL Cell wall hydrolase/muramidase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=acm2 PE=4 SV=1 MKIGMTKKVVTSLLLSTALLPMLSGKADTASANQKPAAATKGNSAASAASQQVTLSAGSQ TETTAAGATDQSVASDGAKTDDQAESTSTTTATTSATSRVTVRAASQAAKADSTGPQSQS SASEAAKDNAATSATADSTTSAVDQLDKTAKASAATSQASHSTTNETAKASAAASQDSHV TTDQSSVTVTSEVAKSAASSAAPKQATEQAVAAKISPKIETAVAADAVQSSAMMARSTRA MTSQEIFLSQIKAGAISGWNKYQVLPSVTAAQAILESGWGQSQLATQGNNLFGIKGSYQG QSIYFPTQEWNGSQYITIQDAFRKYPNWSASVEDHGAFLVVNPRYSNLIGVTDYRRVASL LQQDGYATAPTYASSLISIIEYNKLHEWDQEALSGQASGGNDNNQVQPDQDVTPTSGTHK FTKTTTIHNAPDATSAVVGTYNAGETVNYNGKLTVGNATWLRYQSYSGVSRYVMISQTTT NDNNNQATVTPASGSYKFTAKTNIRSAASKTAQVVGTYNAGETVYYNGKITTGGTTWLRY LSYSGAQHYVAMSGDEVGSVAKPDVVATSGSYRFTKTTAIKSSPATSATTVGSYNAGDTV YYNGKVTTNGQTWLRYMSYSGAQHYVQISGESTSTNVDKPQVTPQSGSYRFTQTTAIKNT PAGNAPSVGTYSAGDTVYYNAKVTANGQTWLRYLSYSGAQHYVAISGNAATGNTTSKPVT NSQGAFRFVTTTNIRTAPSTRASVVGEYNPGETVYYNGTVQAEGYTWLRYLSRSGATHYV AKLEG
Sequence length
785 AA
Subcellular Location
Extracellular
Function
Acm2 is the major autolysin of Lactobacillus plantarum.
Glycosylation Status
Glycosylation Type
O- (Ser) linked
Experimentally Validated Glycosite(s) in Full Length Protein
S86 and S95
Glycosite(s) Annotated Protein Sequence
>tr|F9URD9|F9URD9_LACPL Cell wall hydrolase/muramidase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=acm2 PE=4 SV=1 MKIGMTKKVVTSLLLSTALLPMLSGKADTASANQKPAAATKGNSAASAASQQVTLSAGSQ TETTAAGATDQSVASDGAKTDDQAE
S*(83)
TSTTTATTSAT
S*(95)
RVTVRAASQAAKADSTGPQSQS SASEAAKDNAATSATADSTTSAVDQLDKTAKASAATSQASHSTTNETAKASAAASQDSHV TTDQSSVTVTSEVAKSAASSAAPKQATEQAVAAKISPKIETAVAADAVQSSAMMARSTRA MTSQEIFLSQIKAGAISGWNKYQVLPSVTAAQAILESGWGQSQLATQGNNLFGIKGSYQG QSIYFPTQEWNGSQYITIQDAFRKYPNWSASVEDHGAFLVVNPRYSNLIGVTDYRRVASL LQQDGYATAPTYASSLISIIEYNKLHEWDQEALSGQASGGNDNNQVQPDQDVTPTSGTHK FTKTTTIHNAPDATSAVVGTYNAGETVNYNGKLTVGNATWLRYQSYSGVSRYVMISQTTT NDNNNQATVTPASGSYKFTAKTNIRSAASKTAQVVGTYNAGETVYYNGKITTGGTTWLRY LSYSGAQHYVAMSGDEVGSVAKPDVVATSGSYRFTKTTAIKSSPATSATTVGSYNAGDTV YYNGKVTTNGQTWLRYMSYSGAQHYVQISGESTSTNVDKPQVTPQSGSYRFTQTTAIKNT PAGNAPSVGTYSAGDTVYYNAKVTANGQTWLRYLSYSGAQHYVAISGNAATGNTTSKPVT NSQGAFRFVTTTNIRTAPSTRASVVGEYNPGETVYYNGTVQAEGYTWLRYLSRSGATHYV AKLEG
Sequence Around Glycosites (21 AA)
DGAKTDDQAESTSTTTATTSA
ESTSTTTATTSATSRVTVRAA
ProGP Web Logo
Technique(s) used for Glycosylation Detection
Migration on SDS-PAGE , a lectin blot using GlcNAc-specific succinylated wheat germ agglutinin (sWGA), Glycoprotein enrichment with agarose bound WGA
Technique(s) used for Glycosylated Residue(s) Detection
MALDI-TOF/TOF, LC-MS/MS analysis
Glycan Information
Glycan Annotation
Monosaccharide (Double HexNAc, HexNAc)
Protein Glycosylation linked (PGL) gene(s)
OST ProGT ID
Literature
Reference
Rolain T, Bernard E, Beaussart A, Degand H, Courtin P, Egge-Jacobsen W, Bron PA, Morsomme P, Kleerebezem M, Chapot-Chartier MP, Dufrêne YF, Hols P. (2013) O-glycosylation as a novel control mechanism of peptidoglycan hydrolase activity. J Biol Chem., 288(31):22233-47. [PubMed: 23760506]
Author
Rolain T, Bernard E, Beaussart A, Degand H, Courtin P, Egge-Jacobsen W, Bron PA, Morsomme P, Kleerebezem M, Chapot-Chartier MP, Dufrêne YF, Hols P
Research Group
Institute of Life Sciences, Catholic University of Louvain, B-1348 Louvain-la-Neuve, Belgium
Corresponding Author
Hols P
Contact
Institute of Life Sciences, Catholic University of Louvain, B-1348 Louvain-la-Neuve, Belgium
Reference
Fredriksen L, Moen A, Adzhubei AA, Mathiesen G, Eijsink VG, Egge-Jacobsen W. (2013) Lactobacillus plantarum WCFS1 O-linked protein glycosylation: an extended spectrum of target proteins and modification sites detected by mass spectrometry. Glycobiology, 23(12), 1439-51. [PubMed: 24000282]
Author
Fredriksen L, Moen A, Adzhubei AA, Mathiesen G, Eijsink VG, Egge-Jacobsen W
Research Group
Department of Chemistry, Biotechnology and Food Science, Norwegian University of Life Sciences, 1432 Aas, Norway.
Corresponding Author
Egge-Jacobsen W
Contact
Department of Chemistry, Biotechnology and Food Science, Norwegian University of Life Sciences, 1432 Aas, Norway.
ProCGP (Characterized Glycoproteins)
is a compilation of bacterial and archaeal glycoproteins for which at least one site of glycosylation is validated experimentally using one or multiple methods like, site directed mutagenesis, Edman degradation, mass spectroscopy etc. Each entry in ProCGP has a unique identifier ProGP ID. ProCGP search allows user to seek experimentally verified information about an entry selected by using four different search criteria.
ProUGP (Uncharacterized Glycoproteins)
is a compilation of bacterial and archaeal glycoproteins that are known to be glycosylated from experiments like PAS staining, abberant migration on SDS-PAGE, lectin binding etc. but yet not mapped for the precise position of glycosylated residue (s) in a protein sequence. Each entry in ProUGP has a unique identifier ProGP ID. ProUGP search provides manually curated, published information about selected entry in ProUGP.
Choose Search Criteria
Choose
ProGP ID
Organism
Protein Name
UniProtKB/SwissProt ID
Select Value
Select Value
Choose Display Criteria
All
Organism
Gene Information
Genome Information
Protein Information
Glycosylation Status
Glycan Information
Protein Glycosylation linked (PGL) gene(s)
Accessory PGL Gene(s)
Literature
ProGT_Main (Prokaryotic Protein Glycosyl Transferases):
is a compilation of bacterial and archaeal protein glycosyltransferases for which at least one genetic or biochemical evidence of glycosyltransferase activity is validated in the published literature. Each entry in ProGT_Main has a unique identifier ProGT ID. ProGT_Main search allows user to seek experimentally verified information about an entry selected by using four different search criteria
ProGT_Accessory (Accessory Protein or enzyme to Prokaryotic Protein Glycosyl Transferases):
is a compilation of such bacterial and archaeal proteins/enzyme that have miscellaneous accessory roles in a given protein glycosylation pathway of a characterized protein glycosyltransferases compiled in ProGT_Main. The qualifying criteria is at least one known genetic or biochemical evidence of accessory function, in literature. Each entry in ProGT_Accessory has a unique identifier ProGT ID. ProGT_Accessory search provides manually curated, published information about selected entry.
Choose Search Criteria
Choose
ProGT ID
Organism
Protein Name
UniProtKB/SwissProt ID
Select Value
Search Display Criteria
All
Organism
Gene Information
Genome Information
Protein Name
Glycan Information
Acceptor Subtrate Information
Literature
Search Location
choose Database
Choose
Main
Accessory
ProCGP
ProUGP
Enter ID.
#ex1