ProGP475 (Putative uncharacterized protein)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP475 (Putative uncharacterized protein) |
| Validation Status | Uncharacterized |
| Organism Information | |
| Organism Name | Burkholderia cenocepacia K56-2 |
| Domain | Bacteria |
| Classification | Phylum : Proteobacteria Class : Betaproteobacteria Orders : Burkholderiales Family : Burkholderiaceae Genus : Burkholderia Species : cenocepacia Strain : K56 |
| Taxonomic ID (NCBI) | 985075 |
| Genome Information | |
| GenBank | NZ_LAUA01000000 |
| EMBL | LAUA01000000 |
| Organism Additional Information | Burkholderia cenocepacia causes opportunistic infections in plants, insects, animals and humans. It acts as a health threat to cystic fibrosis patients, causing lethal necrotizing pneumonia in some cases. |
| Gene Information | |
| Gene Name | bcal0193 |
| Protein Information | |
| Protein Name | Putative uncharacterized protein |
| UniProtKB/SwissProt ID | B4EEB8 |
| NCBI RefSeq | WP_006494172.1 |
| EMBL-CDS | CAR50502.1 |
| UniProtKB Sequence | >tr|B4EEB8|B4EEB8_BURCJ Putative exported protein OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=BCAL0193 PE=4 SV=1 MKKTLASIIAAAFALASVSAFAQASAPAADTSAAAPAPAKKDHSKPKHQLKHHGSKKGQA KAAAASAAGTNDAGTQN |
| Sequence length | 77 AA |
| Subcellular Location | Periplasm |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser/Thr) linked |
| Technique(s) used for Glycosylation Detection | ZIC-HILIC, immunoblotting, tryptic digestion, and MS/MS analysis |
| Glycan Information | |
| Glycan Annotation | Trisaccharide HexNAc-HexNAc-Hex. |
| BCSDB ID | 27869 |
| GlyTouCan | G06700QW |
| Protein Glycosylation linked (PGL) gene(s) | |
| OST Gene Name | PglLBC |
| OST ProGT ID | ProGT71 |
| Literature | |
| Year of Identification | 2014 |
| Year of Identification Month Wise | 2014.3.5 |
| Reference | Lithgow, K.V., Scott, N.E., Iwashkiw, J.A., Thomson, E.L., Foster, L.J., Feldman, M.F. and Dennis, J.J., 2014. A general protein O‐glycosylation system within the B urkholderia cepacia complex is involved in motility and virulence. Molecular microbiology, 92(1), pp.116-137. |
| Corresponding Author | Jonathan J. Dennis |
| Contact | Department of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada, |