ProGP478 (Putative uncharacterized protein)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP478 (Putative uncharacterized protein) |
Validation Status | Uncharacterized |
Organism Information | |
Organism Name | Burkholderia cenocepacia K56-2 |
Domain | Bacteria |
Classification | Family: Burkholderiaceae Order: Burkholderiales Class: Betaproteobacteria Division or phylum: "Proteobacteria" |
Taxonomic ID (NCBI) | 985075 |
Genome Information | |
GenBank | NZ_LAUA01000000 |
EMBL | LAUA01000000 |
Organism Additional Information | Burkholderia cenocepacia causes opportunistic infections in plants, insects, animals and humans. It acts as a health threat to cystic fibrosis patients, causing lethal necrotizing pneumonia in some cases. |
Gene Information | |
Gene Name | bcal0786 |
Protein Information | |
Protein Name | Putative uncharacterized protein |
UniProtKB/SwissProt ID | B4EAP9 |
NCBI RefSeq | WP_006499026.1 |
EMBL-CDS | CAR51094.1 |
UniProtKB Sequence | >tr|B4EAP9|B4EAP9_BURCJ Putative membrane protein OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=BCAL0786 PE=4 SV=1 MISINKEPSRPAGTIGWRARIAAWARGPTLARDIALVLIVKLILLMSLKYAFFNHPQAEH MSLPPAAVAEKLLSVPAPASTEGDHHDK |
Sequence length | 88 AA |
Subcellular Location | Inner membrane |
Glycosylation Status | |
Glycosylation Type | O- (Ser/Thr) linked |
Technique(s) used for Glycosylation Detection | ZIC-HILIC,immunoblotting,tryptic digestion, and MS/MS analysis |
Glycan Information | |
Glycan Annotation | Trisaccharide HexNAc-HexNAc-Hex. |
BCSDB ID | 27869 |
GlyTouCan | G06700QW |
Protein Glycosylation linked (PGL) gene(s) | |
OST Gene Name | PglLBC |
OST ProGT ID | ProGT71 (PglLBc) |
Literature | |
Reference | Lithgow, K.V., Scott, N.E., Iwashkiw, J.A., Thomson, E.L., Foster, L.J., Feldman, M.F. and Dennis, J.J., 2014. A general protein O‐glycosylation system within the B urkholderia cepacia complex is involved in motility and virulence. Molecular microbiology, 92(1), pp.116-137. |
Corresponding Author | Jonathan J. Dennis |
Contact | Department of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada, |
Reference | Lithgow KV, Scott NE, Iwashkiw JA, Thomson EL, Foster LJ, Feldman MF, Dennis JJ. (2014) A general protein O-glycosylation system within the Burkholderia cepacia complex is involved in motility and virulence. Mol Microbiol., 92(1):116-37. [PubMed: 24673753] |
Author | Lithgow KV, Scott NE, Iwashkiw JA, Thomson EL, Foster LJ, Feldman MF, Dennis JJ. |
Research Group | Department of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada, |
Corresponding Author | Dennis JJ. |
Contact | Department of Biological Sciences, University of Alberta, Edmonton, Alberta, Canada. |