ProGP50 (Flagellin A)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP50 (Flagellin A)
Validation Status Characterized
Organism Information
Organism NameCampylobacter coli VC 167
Domain Bacteria
Classification Family: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 195
Genome Information
GenBank M64670
EMBL M64670
Organism Additional Information Campylobacter sp. are known to cause bacterial food-borne gastroenteritis. Motility is essential for pathogenicity.
Gene Information
Gene NameflaA
Protein Information
Protein NameFlagellin A
UniProtKB/SwissProt ID P27053
EMBL-CDSAAA23022.1
UniProtKB Sequence >sp|P27053|FLAA_CAMCO Flagellin A OS=Campylobacter coli GN=flaA PE=3 SV=3 MGFRINTNVAALNAKANSDLNSRALDQSLSRLSSGLRINSAADDASGMAIADSLRSQANT LGQAISNGNDALGILQTADKAMDEQLKILDTIKTKATQAAQDGQSLKTRTMLQADINRLM EELDNIANTTSFNGKQLLSGGFTNQEFQIGSSSNQTIKASIGATQSSKIGVTRFETGSQS FSSGTVGLTIKNYNGIEDFKFDSVVISTSVGTGLGALAEEINRNADKTGIRATFDVKSVG AYAIKAGNTSQDFAINGVVIGKVDYSDGDENGSLISAINAVKDTTGVQASKDENGKLVLT SADGRGIKITGSIGVGAGILHTENYGRLSLVKNDGRDINISGTGLSAIGMGATDMISQSS VSLRESKGQISAANADAMGFNAYNGGGAKQIIFASSIAGFMSQAGSGFSAGSGFSVGSGK NYSAILSASIQIVSSARSISSTYVVSTGSGFSAGSGNSQFAALRISTVSAHDETAGVTTL KGAMAVMDIAETAITNLDQIRADIGSVQNQITSTINNITVTQVNVKSAESQIRDVDFASE SANYSKANILAQSGSYAMAQANSSQQNVLRLLQ
Sequence length 573 AA
Subcellular LocationSecreted
Function It is the subunit protein which is polymerized into the flagellar filaments. Motility mediated by flagella is essential for virulence.
Glycosylation Status
Glycosylation Type O- (Ser) linked
Experimentally Validated Glycosite(s) in Full Length Protein(Initiator Met removed) S207, S395, S396, S402, S409, S415, S423, S427, S434, S438, S440, S446, S452
Experimentally Validated Glycosite(s ) in Mature ProteinS206, S394, S395, S401, S408, S414, S422, S426, S433, S437, S439, S445, S451
Glycosite(s) Annotated Protein Sequence >sp|P27053|FLAA_CAMCO Flagellin A OS=Campylobacter coli GN=flaA PE=3 SV=3 MGFRINTNVAALNAKANSDLNSRALDQSLSRLSSGLRINSAADDASGMAIADSLRSQANT LGQAISNGNDALGILQTADKAMDEQLKILDTIKTKATQAAQDGQSLKTRTMLQADINRLM EELDNIANTTSFNGKQLLSGGFTNQEFQIGSSSNQTIKASIGATQSSKIGVTRFETGSQS FSSGTVGLTIKNYNGIEDFKFDSVVIS*(207)TSVGTGLGALAEEINRNADKTGIRATFDVKSVG AYAIKAGNTSQDFAINGVVIGKVDYSDGDENGSLISAINAVKDTTGVQASKDENGKLVLT SADGRGIKITGSIGVGAGILHTENYGRLSLVKNDGRDINISGTGLSAIGMGATDMISQSS VSLRESKGQISAANADAMGFNAYNGGGAKQIIFAS*(395)S*(396)IAGFMS*(402)QAGSGFS*(409)AGSGFS*(415)VGSGK NYS*(423)AILS*(427)ASIQIVS*(434)SARS*(438)IS*(440)STYVVS*(446)TGSGFS*(452)AGSGNSQFAALRISTVSAHDETAGVTTL KGAMAVMDIAETAITNLDQIRADIGSVQNQITSTINNITVTQVNVKSAESQIRDVDFASE SANYSKANILAQSGSYAMAQANSSQQNVLRLLQ
Sequence Around Glycosites (21 AA) EDFKFDSVVISTSVGTGLGAL
GGGAKQIIFASSIAGFMSQAG
GGAKQIIFASSIAGFMSQAGS
IFASSIAGFMSQAGSGFSAGS
GFMSQAGSGFSAGSGFSVGSG
GSGFSAGSGFSVGSGKNYSAI
GFSVGSGKNYSAILSASIQIV
GSGKNYSAILSASIQIVSSAR
AILSASIQIVSSARSISSTYV
ASIQIVSSARSISSTYVVSTG
IQIVSSARSISSTYVVSTGSG
ARSISSTYVVSTGSGFSAGSG
TYVVSTGSGFSAGSGNSQFAA
ProGP Web Logo
Technique(s) used for Glycosylation DetectionBiotin-hydrazide labeling after periodate oxidation, sialic acid-specific lectin LFA (limax flavus agglutinin)-binding, mass excess (approx. 6 kDa) detected by intact mass analysis using ESMS (electrospray mass spectrometry)
Technique(s) used for Glycosylated Residue(s) Detection Edman sequencing
Protein Glycosylation- Implication Sone level of glycosylation is necessary for filament assembly. Modification with either Pse5Ac7Ac or PseAm is sufficient for filament assembly.Modification with pseudaminic acid and derivatives is essential for targeting and/or secretion of flagellin. Glycosylation may be required for interaction of the subunits with the flagellin chaperone, FliS, with other components of the flagellar structure or in subunit interactions.
Glycan Information
Glycan Annotation More Pse5Ac7Ac (5,7-diacetamido-3,5,7,9-tetradeoxy-L-glycero-L-manno-nonulosonic acid) in this case than from 81-176. Acetamidino and N-methylacetimidoyl derivatives of legionaminic acid, 315 Da Leg5Am7Ac (5-acetamidino-7-acetamido-3,5,7,9,-tetradeoxy-D-glycero-D-galacto-nonulosonic acid) and Leg5AmNMe7Ac (5-E/Z-N-(N-methylacetimidoyl)-7-acetamidino-3,5,7,9-tetradeoxy-D-glycero-D-galacto-nonulosonic), are also present. Leg5Ac7Ac (Leg) is legionaminic acid and Pse5Ac7Ac (Pse) is pseudaminic acid.
BCSDB ID 21877
GlyTouCan G07086CL
Technique(s) used for Glycan Identification Homo- and heteronuclear correlated two-dimensional 1H NMR, 13C HSQC (heteronuclear single quantum coherence), HMBC (heteronuclear multiple bond coherence), COSY (correlated spectroscopy), TOCSY (total correlation spectroscopy), and NOESY (nuclear Overhauser effect spectroscopy).
Literature
Year of Identification1989
Year of Identification Month Wise1989.06
Year of Validation 1989
ReferenceLogan, S.M., Hui, J.P., Vinogradov, E., Aubry, A.J., Melanson, J.E., Kelly, J.F., Nothaft, H. and Soo, E.C., 2009. Identification of novel carbohydrate modifications on Campylobacter jejuni 11168 flagellin using metabolomics‐based approaches. The FEBS Journal, 276(4), pp.1014-1023.
Corresponding Author Patricia Guerry
ContactEnteric Diseases Department, Naval Medical Research Center, 503 Robert Grant Ave., Silver Spring, MD 20910, USA.
ReferenceMcNally, D.J., Aubry, A.J., Hui, J.P., Khieu, N.H., Whitfield, D., Ewing, C.P., Guerry, P., Brisson, J.R., Logan, S.M. and Soo, E.C., 2007. Targeted metabolomics analysis of Campylobacter coli VC167 reveals legionaminic acid derivatives as novel flagellar glycans. Journal of Biological Chemistry, 282(19), pp.14463-14475.
Corresponding Author Susan M Logan
Evelyn C. Soo
ContactInstitute for Biological Sciences, National Research Council of Canada, Ottawa, Ontario K1A 0R6, Canada.
National Research Council, Institute for Marine Biosciences, Halifax, Nova Scotia B3H 3Z1, Canada
ReferenceGoon, S., Kelly, J.F., Logan, S.M., Ewing, C.P. and Guerry, P., 2003. Pseudaminic acid, the major modification on Campylobacter flagellin, is synthesized via the Cj1293 gene. Molecular microbiology, 50(2), pp.659-671.
Corresponding Author Patricia Guerry
ContactEnteric Diseases Department, Naval Medical Research Center, 503 Robert Grant Ave., Silver Spring, MD 20910, USA.
ReferenceLogan, S.M., Kelly, J.F., Thibault, P., Ewing, C.P. and Guerry, P., 2002. Structural heterogeneity of carbohydrate modifications affects serospecificity of Campylobacter flagellins. Molecular microbiology, 46(2), pp.587-597.
Corresponding Author Patricia Guerry
ContactEnteric Diseases Department, Naval Medical Research Center, 503 Robert Grant Ave., Silver Spring, MD 20910, USA.
ReferenceThibault, P., Logan, S.M., Kelly, J.F., Brisson, J.R., Ewing, C.P. and Guerry, P., 2001. Identification of the carbohydrate moieties and glycosylation motifs in Campylobacter jejuni flagellin. Journal of Biological Chemistry, 276(37), pp.34862-34870.
Corresponding Author Susan M Logan
ContactInstitute for Biological Sciences, National Research Council of Canada, Ottawa, Ontario K1A 0R6, Canada.
ReferenceDoig, P., Kinsella, N., Guerry, P. and Trust, T.J., 1996. Characterization of a post‐translational modification of Campylobacter flagellin: identification of a sero‐specific glycosyl moiety. Molecular microbiology, 19(2), pp.379-387.
Corresponding Author Trevor J. Trust
ContactDepartment of Biochemistry and Microbiology, University of Victoria, British Columbia, Canada.
ReferenceLogan, S.M., Trust, T.J. and Guerry, P., 1989. Evidence for posttranslational modification and gene duplication of Campylobacter flagellin. Journal of bacteriology, 171(6), pp.3031-3038.
Corresponding Author Patricia Guerry
ContactEnteric Diseases Department, Naval Medical Research Center, 503 Robert Grant Ave., Silver Spring, MD 20910, USA.
ReferenceGuerry, P., Doig, P., Alm, R.A., Burr, D.H., Kinsella, N. and Trust, T.J., 1996. Identification and characterization of genes required for post‐translational modification of Campylobacter coli VC167 flagellin. Molecular microbiology, 19(2), pp.369-378.
Corresponding Author Patricia Guerry
ContactEnteric Diseases Department, Naval Medical Research Center, 503 Robert Grant Ave., Silver Spring, MD 20910, USA.
ReferenceLogan, S.M., Hui, J.P., Vinogradov, E., Aubry, A.J., Melanson, J.E., Kelly, J.F., Nothaft, H. and Soo, E.C. (2009) Identification of novel carbohydrate modifications on Campylobacter jejuni 11168 flagellin using metabolomics-based approaches. FEBS J, 276, 1014-1023. [PMID: 19154343]
AuthorLogan, S.M., Hui, J.P., Vinogradov, E., Aubry, A.J., Melanson, J.E., Kelly, J.F., Nothaft, H. and Soo, E.C.
Research GroupNRC-Institute for Biological Sciences, Ottawa, Canada.
Corresponding Author Soo, E.C.
ContactNRC-Institute for Biological Sciences, Ottawa, Canada.
ReferenceMcNally, D.J., Aubry, A.J., Hui, J.P., Khieu, N.H., Whitfield, D., Ewing, C.P., Guerry, P., Brisson, J.R., Logan, S.M. and Soo, E.C. (2007) Targeted metabolomics analysis of Campylobacter coli VC167 reveals legionaminic acid derivatives as novel flagellar glycans. J Biol Chem, 282, 14463-14475. [PubMed: 17371878]
Author McNally, D.J., Aubry, A.J., Hui, J.P., Khieu, N.H., Whitfield, D., Ewing, C.P., Guerry, P., Brisson, J.R., Logan, S.M. and Soo, E.C.
Research GroupNational Research Council, Institute for Biological Sciences, Ottawa, Ontario, Canada.
Corresponding Author Soo, E.C.
ContactNational Research Council, Institute for Biological Sciences, Ottawa, Ontario, Canada.
ReferenceGoon, S., Kelly, J.F., Logan, S.M., Ewing, C.P. and Guerry, P. (2003) Pseudaminic acid, the major modification on Campylobacter flagellin, is synthesized via the Cj1293 gene. Mol Microbiol, 50, 659-671. [PubMed: 14617187]
Author Goon, S., Kelly, J.F., Logan, S.M., Ewing, C.P. Guerry, P.
Research GroupEnteric Diseases Department, Naval Medical Research Center, Silver Spring, MD 20910, USA.
Corresponding Author Guerry, P.
ContactEnteric Diseases Department, Naval Medical Research Center, Silver Spring, MD 20910, USA.
ReferenceLogan, S.M., Kelly, J.F., Thibault, P., Ewing, C.P. and Guerry, P. (2002) Structural heterogeneity of carbohydrate modifications affects serospecificity of Campylobacter flagellins. Mol Microbiol, 46, 587-597. [PubMed: 12406231]
Author Logan, S.M., Kelly, J.F., Thibault, P., Ewing, C.P. Guerry, P.
Research GroupLondon School of Hygiene and Tropical Medicine,
Corresponding Author Guerry, P.
ContactLondon School of Hygiene and Tropical Medicine,
ReferenceThibault, P., Logan, S.M., Kelly, J.F., Brisson, J.R., Ewing, C.P., Trust, T.J. and Guerry, P. (2001) Identification of the carbohydrate moieties and glycosylation motifs in Campylobacter jejuni flagellin. J Biol Chem, 276, 34862-34870. [PubMed: 11461915]
Author Thibault, P., Logan, S.M., Kelly, J.F., Brisson, J.R., Ewing, C.P., Trust, T.J. Guerry, P.
Research GroupInstitute for Biological Sciences, National Research Council of Canada, Ottawa, Ontario K1A 0R6, Canada.
Corresponding Author Guerry, P.
ContactInstitute for Biological Sciences, National Research Council of Canada, Ottawa, Ontario K1A 0R6, Canada.
Reference Doig, P., Kinsella, N., Guerry, P. and Trust, T.J. (1996) Characterization of a post-translational modification of Campylobacter flagellin: identification of a sero-specific glycosyl moiety. Mol Microbiol, 19, 379-387. [PubMed: 8825782]
Author Doig, P., Kinsella, N., Guerry, P. and Trust, T.J
Research GroupDepartment of Biochemistry and Microbiology, University of Victoria, British Columbia, Canada.
Corresponding Author Trust, T.J.
ContactDepartment of Biochemistry and Microbiology, University of Victoria, British Columbia, Canada.
Reference Logan, S.M., Trust, T.J. and Guerry, P. (1989) Evidence for posttranslational modification and gene duplication of Campylobacter flagellin. J Bacteriol, 171, 3031-3038. [PubMed: 2722741]
Author Logan, S.M., Trust, T.J. and Guerry, P
Corresponding Author Guerry, P
ReferenceGuerry, P., Doig, P., Alm, R.A., Burr, D.H., Kinsella, N. and Trust, T.J. (1996) Identification and characterization of genes required for post-translational modification of Campylobacter coli VC167 flagellin. Mol Microbiol, 19, 369-378. [PubMed: 8825781]
AuthorGuerry, P., Doig, P., Alm, R.A., Burr, D.H., Kinsella, N. and Trust, T.J
Research GroupEnteric Diseases Program, Naval Medical Research Institute, Bethesda, Maryland 20889, USA.
Corresponding Author Trust, T.J.
ContactEnteric Diseases Program, Naval Medical Research Institute, Bethesda, Maryland 20889, USA.