ProGP512 (Enterocin F4-9)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP512 (Enterocin F4-9) |
| Validation Status | Characterized |
| Organism Information | |
| Organism Name | Enterococcus faecalis F4-9 |
| Domain | Bacteria |
| Classification | Phylum : Firmicutes Class : Bacilli Orders : Lactobacillales Family : Enterococcaceae Genus : Enterococcus Species : faecalis Strain : F4-9 |
| Taxonomic ID (NCBI) | 1351 |
| Genome Information | |
| GenBank | LC029806.1 |
| EMBL | LC029806.1 |
| Gene Information | |
| Gene Name | enfA49 |
| GenBank Gene Sequence | LC029806.1 |
| Protein Information | |
| Protein Name | Enterocin F4-9 |
| UniProtKB/SwissProt ID | A0A0G4DCS0 |
| NCBI RefSeq | WP_002396198.1 |
| EMBL-CDS | BAR87969.1 |
| UniProtKB Sequence | >tr|A0A0G4DCS0|A0A0G4DCS0_ENTFL Enterocin F4-9 OS=Enterococcus faecalis GN=enfA49 PE=4 SV=1 MGNSILNKMTVEEMEAVKGGNLVCPPMPDYIKRLSTGKGVSSVYMAWQIANCKSSGSCMKGQTNRTC |
| Sequence length | 67 AA |
| Subcellular Location | Extracellular |
| Function | Bacteriocin |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser/Thr) linked |
| Experimentally Validated Glycosite(s) in Full Length Protein | S37 and T46 |
| Glycosite(s) Annotated Protein Sequence | >tr|A0A0G4DCS0|A0A0G4DCS0_ENTFL Enterocin F4-9 OS=Enterococcus faecalis GN=enfA49 PE=4 SV=1 MGNSILNKMTVEEMEAVKGGNLVCPPMPDYIKRLSTGKGVSSVYMAWQIANCKSSGS*(37)CMKGQTNRT*(46)C |
| Sequence Around Glycosites (21 AA) | WQIANCKSSGSCMKGQTNRTC |
| Technique(s) used for Glycosylation Detection | Mass spectrometry (ESI-TOF MS) |
| Technique(s) used for Glycosylated Residue(s) Detection | Deglycosylation and Edman degradation |
| Protein Glycosylation- Implication | Essential for bioactivity |
| Glycan Information | |
| Glycan Annotation | GlcNAc |
| Technique(s) used for Glycan Identification | Deglycosylation using β-N-acetylglucosaminidase |
| Literature | |
| Year of Identification | 2015 |
| Year of Identification Month Wise | 2015.05.08 |
| Year of Validation | 2015 |
| Reference | Maky, M.A., Ishibashi, N., Zendo, T., Perez, R.H., Doud, J.R., Karmi, M. and Sonomoto, K., 2015. Enterocin F4-9, a novel O-linked glycosylated bacteriocin. Applied and environmental microbiology, 81(14), pp.4819-4826. |
| Corresponding Author | Kenji Sonomoto |
| Contact | Laboratory of Microbial Technology, Division of Systems Bioengineering, Department of Bioscience and Biotechnology, Faculty of Agriculture, Graduate School, Kyushu University, Higashi-ku, Fukuoka, Japan Department of Functional Metabolic Design, Bio-Architecture Center, Kyushu University, Fukuoka, Japan |
