ProGP541 (FtsL)
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP541 (FtsL) |
| Validation Status | Uncharacterized |
| Organism Information | |
| Organism Name | Ralstonia solanacearum GMI1000 |
| Domain | Bacteria |
| Classification | Family:Burkholderiaceae Order: Burkholderiales Class: Betaproteobacteria Division or phylum: "Proteobacteria" |
| Taxonomic ID (NCBI) | 267608 |
| Genome Information | |
| GenBank | NC_003295.1 |
| EMBL | AL646052.1 |
| Gene Information | |
| Gene Name | ftsL |
| NCBI Gene ID | 1221699 |
| GenBank Gene Sequence | NC_003295.1 |
| Protein Information | |
| Protein Name | FtsL |
| UniProtKB/SwissProt ID | Q8XVI0 |
| NCBI RefSeq | WP_011002756.1 |
| EMBL-CDS | CAD16558.1 |
| UniProtKB Sequence | >tr|Q8XVI0|Q8XVI0_RALSO Cell division protein FtsL OS=Ralstonia solanacearum (strain GMI1000) GN=ftsL PE=3 SV=1 MNRLNMFLLTALVLCALSLVNAQHQARQLFVELDRAQAEEKQLNIDWSRLQYEQSSLGKS ARIAEIARTQLKMAPAQAGRTQYLQGFADLPAAASAAASAPAASGVQP |
| Sequence length | 108 AA |
| Subcellular Location | Cell inner membrane, Single-pass type II Membrane |
| Function | Cell division protein , Essential cell division protein. May link together the upstream cell division proteins, which are predominantly cytoplasmic, with the downstream cell division proteins, which are predominantly periplasmic. |
| Glycosylation Status | |
| Glycosylation Type | O- (Ser/Thr) linked |
| Technique(s) used for Glycosylation Detection | ZIC-HILIC , LC-MS, CID MS/MS and HCD MS/MS |
| Glycan Information | |
| Glycan Annotation | Pentasaccharide composed of HexNAc-(Pen)-dHex3, which is similar to the O antigen subunit characterized in the LPS structures of multiple R. solanacearum strains. |
| Protein Glycosylation linked (PGL) gene(s) | |
| OST Gene Name | PglLRs |
| OST ProGT ID | ProGT104 (PglLRs) |
| Literature | |
| Reference | Elhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF. (2016) Protein O-linked glycosylation in the plant pathogen Ralstonia solanacearum. Glycobiology., 26(3):301-11. [PMID: 26531228] |
| Author | Elhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF. |
| Research Group | 1 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada. 2 Centre for High-Throughput Biology, University of British Columbia, Vancouver, BC, Canada. 3 Faculty of Biochemical and Pharmaceutical Sciences (FBIOYF-UNR), Institute of Molecular and Cellular Biology of Rosario (IBR-CONICET), Rosario, Santa Fe, Argentina. 4 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA |
| Corresponding Author | Feldman MF |
| Contact | Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA |