ProGP541 (FtsL)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP541 (FtsL) |
Validation Status | Uncharacterized |
Organism Information | |
Organism Name | Ralstonia solanacearum GMI1000 |
Domain | Bacteria |
Classification | Family:Burkholderiaceae Order: Burkholderiales Class: Betaproteobacteria Division or phylum: "Proteobacteria" |
Taxonomic ID (NCBI) | 267608 |
Genome Information | |
GenBank | NC_003295.1 |
EMBL | AL646052.1 |
Gene Information | |
Gene Name | ftsL |
NCBI Gene ID | 1221699 |
GenBank Gene Sequence | NC_003295.1 |
Protein Information | |
Protein Name | FtsL |
UniProtKB/SwissProt ID | Q8XVI0 |
NCBI RefSeq | WP_011002756.1 |
EMBL-CDS | CAD16558.1 |
UniProtKB Sequence | >tr|Q8XVI0|Q8XVI0_RALSO Cell division protein FtsL OS=Ralstonia solanacearum (strain GMI1000) GN=ftsL PE=3 SV=1 MNRLNMFLLTALVLCALSLVNAQHQARQLFVELDRAQAEEKQLNIDWSRLQYEQSSLGKS ARIAEIARTQLKMAPAQAGRTQYLQGFADLPAAASAAASAPAASGVQP |
Sequence length | 108 AA |
Subcellular Location | Cell inner membrane, Single-pass type II Membrane |
Function | Cell division protein , Essential cell division protein. May link together the upstream cell division proteins, which are predominantly cytoplasmic, with the downstream cell division proteins, which are predominantly periplasmic. |
Glycosylation Status | |
Glycosylation Type | O- (Ser/Thr) linked |
Technique(s) used for Glycosylation Detection | ZIC-HILIC , LC-MS, CID MS/MS and HCD MS/MS |
Glycan Information | |
Glycan Annotation | Pentasaccharide composed of HexNAc-(Pen)-dHex3, which is similar to the O antigen subunit characterized in the LPS structures of multiple R. solanacearum strains. |
Protein Glycosylation linked (PGL) gene(s) | |
OST Gene Name | PglLRs |
OST ProGT ID | ProGT104 (PglLRs) |
Literature | |
Reference | Elhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF. (2016) Protein O-linked glycosylation in the plant pathogen Ralstonia solanacearum. Glycobiology., 26(3):301-11. [PMID: 26531228] |
Author | Elhenawy W, Scott NE, Tondo ML, Orellano EG, Foster LJ, Feldman MF. |
Research Group | 1 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada. 2 Centre for High-Throughput Biology, University of British Columbia, Vancouver, BC, Canada. 3 Faculty of Biochemical and Pharmaceutical Sciences (FBIOYF-UNR), Institute of Molecular and Cellular Biology of Rosario (IBR-CONICET), Rosario, Santa Fe, Argentina. 4 Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA |
Corresponding Author | Feldman MF |
Contact | Department of Biological Sciences, University of Alberta, Edmonton, AB, Canada Department of Molecular Microbiology, Washington University School of Medicine St. Louis, St. Louis, MO, USA |