ProGP552 (Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP552 (Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96) |
Validation Status | Characterized |
Organism Information | |
Organism Name | Enterococcus faecalis TX0104 |
Domain | Bacteria |
Classification | Family:Enterococcaceae Order: Lactobacillales Class: Bacilli Division or phylum: "Firmicutes" |
Taxonomic ID (NCBI) | 491074 |
Genome Information | |
GenBank | GG668924.1 |
EMBL | GG668924.1 |
Gene Information | |
Gene Name | HMPREF0348_0422 |
GenBank Gene Sequence | ACGL01000031.1 |
Protein Information | |
Protein Name | Hypothetical protein but identical to entrocin96 of Enterococcus faecalis WHE96 |
UniProtKB/SwissProt ID | C0X1N7 |
NCBI RefSeq | WP_002382828 |
UniProtKB Sequence | >tr|C0X1N7|C0X1N7_ENTFL Uncharacterized protein OS=Enterococcus faecalis TX0104 GN=HMPREF0348_0422 PE=4 SV=1 MERTKGDNTMLNKKLLENGVVNAVTIDELDAQFGGMSKRDCNLMKACCAGQAVTYAIHSLLNRLGGDSSDPAGCNDIVRKYCK |
Sequence length | 83 AA |
Glycosylation Status | |
Glycosylation Type | O- (Ser) and S- (Cys) linked |
Experimentally Validated Glycosite(s) in Full Length Protein | S33 (C33 when S33 replaced with C33) |
Glycosite(s) Annotated Protein Sequence | >tr|C0X1N7|C0X1N7_ENTFL Uncharacterized protein OS=Enterococcus faecalis TX0104 GN=HMPREF0348_0422 PE=4 SV=1 MERTKGDNTMLNKKLLENGVVNAVTIDELDAQFGGMSKRDCNLMKACCAGQAVTYAIHSLLNRLGGDS*(33)SDPAGCNDIVRKYCK |
Sequence Around Glycosites (21 AA) | HSLLNRLGGDSSDPAGCNDIV |
Technique(s) used for Glycosylated Residue(s) Detection | LC ESI-MS, MALDI-TOF MS and tandem MS |
Protein Glycosylation- Implication | It is a di-glycosylated bacteriocin and active in glucosylated form only.Its antimicrobial activity affected by both nature and number of sugars attached to EC peptide affect its bioactivity against Listeria species |
Glycan Information | |
Glycan Annotation | single- and double glucosylated ( glucose and galactose |
Protein Glycosylation linked (PGL) gene(s) | |
OST Gene Name | EntS |
OST ProGT ID | ProGT116 (EntS) |
Literature | |
Reference | Nagar R, Rao A (2017) An iterative glycosyltransferase EntS catalyzes transfer and extension of O- and S-linked monosaccharide in enterocin 96. Glycobiology, 12. [PubMed: 28498962] |
Author | Nagar R, Rao A |
Research Group | CSIR-Institute of Microbial Technology, Sector 39A, Chandigarh-160036, India. |
Corresponding Author | Rao A |
Contact | CSIR-Institute of Microbial Technology, Sector 39A, Chandigarh-160036, India. |