ProGP70 ((1,3-1,4)-beta-glucanase (MAC))

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP70 ((1,3-1,4)-beta-glucanase (MAC))
Validation Status Uncharacterized
Organism Information
Organism NamePaenibacillus (Bacillus) macerans
Domain Bacteria
Classification Family: Bacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 44252
Genome Information
GenBank X55959
EMBL X55959
Protein Information
Protein Name(1,3-1,4)-beta-glucanase (MAC)
UniProtKB/SwissProt ID P23904
EMBL-CDSCAA39426.1
UniProtKB Sequence >sp|P23904|GUB_PAEMA Beta-glucanase OS=Paenibacillus macerans PE=1 SV=2 MKKKSCFTLVTTFAFSLIFSVSALAGSVFWEPLSYFNRSTWEKADGYSNGGVFNCTWRAN NVNFTNDGKLKLGLTSSAYNKFDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYTGP AHGTQWDEIDIEFLGKDTTKVQFNYYTNGVGGHEKVISLGFDASKGFHTYAFDWQPGYIK WYVDGVLKHTATANIPSTPGKIMMNLWNGTGVDDWLGSYNGANPLYAEYDWVKYTSN
Sequence length 237 AA
Subcellular LocationSecreted
Function Catalyses cleavage of (1,4)-beta-linkages of O-substituted beta-D-glucanopyranosyl residues.
Glycosylation Status
Glycosylation Type N- (Asn) linked
Glycan Information
Glycan Annotation Linkage: GlcNAc-N-Asn
Literature
Year of Identification1991
Year of Identification Month Wise1990.12.07
ReferenceMeldgaard, M., 1994. Different effects of N-glycosylation on the thermostability of highly homologous bacterial (1, 3-1, 4)-β-glucanases secreted from yeast. Microbiology, 140(1), pp.159-166.
Corresponding Author Morten Meldgaard
ContactDepartment of Physiology, Carlsberg Laboratory, Copenhagen, Denmark.
ReferenceOlsen, O. and Thomsen, K.K., 1991. Improvement of bacterial β-glucanase thermostability by glycosylation. Microbiology, 137(3), pp.579-585.
Corresponding Author Karl KristianThomesen
ContactCarlsberg Laboratory, Department of Physiology, Gamle Carlsbergvej 10, DK-2500 Copenhagen Valby, Denmark
ReferenceMeldgaard, M. and Svendsen, I. (1994) Different effects of N-glycosylation on the thermostability of highly homologous bacterial (1,3-1,4)-beta-glucanases secreted from yeast. Microbiology, 140 ( Pt 1), 159-166. [PubMed: 8162185]
Author Svendsen, I.
Research GroupDepartment of Physiology, Carlsberg Laboratory, Copenhagen, Denmark.
Corresponding Author Meldgaard, M. Svendsen, I.
ContactDepartment of Physiology, Carlsberg Laboratory, Copenhagen, Denmark.
ReferenceOlsen, O., Thomesen, K. K. (1991) Improvement of bacterial P-glucanase thermostability by glycosylation. J Gen Microbiol, 137, 579–585.
AuthorOlsen, O., Thomesen, K. K.
Research GroupCarlsberg Laboratory, Department of Physiology, Gamle Carlsbergvej 10, DK-2500 Copenhagen Valby, Denmark
Corresponding Author Thomesen, K. K.
ContactCarlsberg Laboratory, Department of Physiology, Gamle Carlsbergvej 10, DK-2500 Copenhagen Valby, Denmark