ProGP70 ((1,3-1,4)-beta-glucanase (MAC))
Home -> ProGPdb -> Search ProGP -> Display data
| ProGP ID | ProGP70 ((1,3-1,4)-beta-glucanase (MAC)) |
| Validation Status | Uncharacterized |
| Organism Information | |
| Organism Name | Paenibacillus (Bacillus) macerans |
| Domain | Bacteria |
| Classification | Family: Bacillaceae Order: Bacillales Class: Bacilli (or Firmibacteria) Division or phylum: "Firmicutes" |
| Taxonomic ID (NCBI) | 44252 |
| Genome Information | |
| GenBank | X55959 |
| EMBL | X55959 |
| Protein Information | |
| Protein Name | (1,3-1,4)-beta-glucanase (MAC) |
| UniProtKB/SwissProt ID | P23904 |
| EMBL-CDS | CAA39426.1 |
| UniProtKB Sequence | >sp|P23904|GUB_PAEMA Beta-glucanase OS=Paenibacillus macerans PE=1 SV=2 MKKKSCFTLVTTFAFSLIFSVSALAGSVFWEPLSYFNRSTWEKADGYSNGGVFNCTWRAN NVNFTNDGKLKLGLTSSAYNKFDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYTGP AHGTQWDEIDIEFLGKDTTKVQFNYYTNGVGGHEKVISLGFDASKGFHTYAFDWQPGYIK WYVDGVLKHTATANIPSTPGKIMMNLWNGTGVDDWLGSYNGANPLYAEYDWVKYTSN |
| Sequence length | 237 AA |
| Subcellular Location | Secreted |
| Function | Catalyses cleavage of (1,4)-beta-linkages of O-substituted beta-D-glucanopyranosyl residues. |
| Glycosylation Status | |
| Glycosylation Type | N- (Asn) linked |
| Glycan Information | |
| Glycan Annotation | Linkage: GlcNAc-N-Asn |
| Literature | |
| Year of Identification | 1991 |
| Year of Identification Month Wise | 1990.12.07 |
| Reference | Meldgaard, M., 1994. Different effects of N-glycosylation on the thermostability of highly homologous bacterial (1, 3-1, 4)-β-glucanases secreted from yeast. Microbiology, 140(1), pp.159-166. |
| Corresponding Author | Morten Meldgaard |
| Contact | Department of Physiology, Carlsberg Laboratory, Copenhagen, Denmark. |
| Reference | Olsen, O. and Thomsen, K.K., 1991. Improvement of bacterial β-glucanase thermostability by glycosylation. Microbiology, 137(3), pp.579-585. |
| Corresponding Author | Karl KristianThomesen |
| Contact | Carlsberg Laboratory, Department of Physiology, Gamle Carlsbergvej 10, DK-2500 Copenhagen Valby, Denmark |
| Reference | Meldgaard, M. and Svendsen, I. (1994) Different effects of N-glycosylation on the thermostability of highly homologous bacterial (1,3-1,4)-beta-glucanases secreted from yeast. Microbiology, 140 ( Pt 1), 159-166. [PubMed: 8162185] |
| Author | Svendsen, I. |
| Research Group | Department of Physiology, Carlsberg Laboratory, Copenhagen, Denmark. |
| Corresponding Author | Meldgaard, M. Svendsen, I. |
| Contact | Department of Physiology, Carlsberg Laboratory, Copenhagen, Denmark. |
| Reference | Olsen, O., Thomesen, K. K. (1991) Improvement of bacterial P-glucanase thermostability by glycosylation. J Gen Microbiol, 137, 579–585. |
| Author | Olsen, O., Thomesen, K. K. |
| Research Group | Carlsberg Laboratory, Department of Physiology, Gamle Carlsbergvej 10, DK-2500 Copenhagen Valby, Denmark |
| Corresponding Author | Thomesen, K. K. |
| Contact | Carlsberg Laboratory, Department of Physiology, Gamle Carlsbergvej 10, DK-2500 Copenhagen Valby, Denmark |