ProGP706 (Listeriocytocin)
Home -> ProGPdb -> Search ProGP -> Display data
ProGP ID | ProGP706 (Listeriocytocin) |
Validation Status | Characterized |
Organism Information | |
Organism Name | Listeria monocytogenes SLCC2540 |
Domain | Bacteria |
Classification | Phylum : Firmicutes Class : Bacilli Orders : Bacillales Family : Bacillaceae Genus : Listeria Species : monocytogenes Strain : SLCC2540 |
Taxonomic ID (NCBI) | 879089 |
Gene Information | |
Gene Name | listeriocytocin |
Protein Information | |
Protein Name | Listeriocytocin |
NCBI RefSeq | WP_070308991.1 |
UniProtKB Sequence | >WP_070308991.1 MULTISPECIES: hypothetical protein [Listeria] KMSKAWCRSMVVSCVYNLVDFSSSSDGKKTCALYRKYC |
Subcellular Location | Secreted |
Function | Show antimicrobial activity against Bacillus cereus ATCC 14582 |
Glycosylation Status | |
Glycosylation Type | O-(Ser) linked |
Experimentally Predicted Glycosites | S25 |
Experimentally Validated Glycosite(s) in Full Length Protein | S25 |
Experimentally Validated Glycosite(s ) in Mature Protein | >WP_070308991.1 MULTISPECIES: hypothetical protein [Listeria] KMSKAWCRSMVVSCVYNLVDFSS*(25)SSDGKKTCALYRKYC |
Glycosite(s) Annotated Protein Sequence | SCVYNLVDFSSSSDGKKTCAL |
Technique(s) used for Glycosylation Detection | MS/MS analysis |
Glycan Information | |
Glycan Annotation | di-glucose |
Technique(s) used for Glycan Identification | MS/MS analysis |
Protein Glycosylation linked (PGL) gene(s) | |
OST Gene Name | GT |
OST ProGT ID | ProGT130 (GT) |
Literature | |
Year of Identification | 2018 |
Reference | Ren, H., Biswas, S., Ho, S., Van Der Donk, W.A. and Zhao, H., 2018. Rapid discovery of glycocins through pathway refactoring in Escherichia coli. ACS chemical biology, 13(10), pp.2966-2972. |
Corresponding Author | Wilfred A. van der Donk Huimin Zhao |
Contact | Department of Chemistry, Howard Hughes Medical Institute, Carl R. Woese Institute for Genomic Biology, University of Illinois at Urbana?Champaign, Urbana, Illinois 61801, United States |