| ProGT ID | ProGT37.1 (Gtf3) |
| Organism Information | |
| Organism Name | Streptococcus parasanguinis FW213 |
| Domain | Bacteria |
| Classification | Phylum : Firmicutes Class : Bacilli Orders : Lactobacillales Family : Streptococcaceae Genus : Stretococcus Species : parasanguinis |
| Taxonomic ID (NCBI) | 1318 |
| Genome Information | |
| Gene Bank | EU821531.1 |
| EMBL | EU821531.1 |
| Gene Information | |
| Gene Name | nss |
| NCBI Reference Sequence | ACF35267.1 |
| Protein information | |
| Protein Name | Gtf3 |
| UniProtKB/ SwissProt ID | B5A7L9 |
| UniProtKB Sequence | >tr|B5A7L9|B5A7L9_STRPA Nucleotide sugar synthetase-like protein OS=Streptococcus parasanguinis GN=nss PE=1 SV=1 MRVYITNINGQSIQSTAQLCQNTVTDVAVSLGYRELGIYCYQIHTDSESELSKRLDGIVA GLRHGDVVIFQTPTWNTTEFDEKLMNKLKLYDIKIVLFIHDVVPLMFSGNFYLMDRTIAY YNKADVVVAPSQKMIDKLRDFGMNVSKTVVQGMWDHPTQAPMFPAGLKREIHFPGNPERF SFVKEWKYDIPLKVYTWQNVELPQNVHKINYRPDEQLLMEMSQGGFGLVWMDDKDKEYQS LYCSYKLGSFLAAGIPVIVQEGIANQELIENNGLGWIVKDVEEAIMKVKNVNEDEYIELV KNVRSFNPILRKGFFTRRLLTESVFQAICD |
| EMBL CDS | ACF35267.1. |
| Sequence length | 330 AA |
| PDB ID (Structural Information) | 3QKW, 3RHZ |
| Glycosylation Information | |
| CAZY Family | GTNC |
| EC Number (BRENDA) | 2.4.1.- |
| Sugar Donor Specificity | UDP-Glc |
| Acceptor Substrate Specificity | Glc-GalNAc modified Fap1 |
| Experimental Validation | In vitro and In vivo |
| Donor Specificity | UDP-Glc |
| Function in Glycosylation pathway | 1) Transfer Glucose to the Glc-GalNAc modified Fap1. |
| Additional Information | 1) Gtf3 transfer Glucose on previously modified Fap1 protein and it also plays an important role in the biofilm formation by S. parasanguinis. |
| Litrature | |
| Year Of Validation | 2010 |
| Reference | Zhou, M., Zhu, F., Dong, S., Pritchard, D.G. and Wu, H., 2010. A novel glucosyltransferase is required for glycosylation of a serine-rich adhesin and biofilm formation by Streptococcus parasanguinis. Journal of Biological Chemistry, 285(16), pp.12140-12148. |
| Corresponding Author | Department of Pediatric Dentistry, University of Alabama at Birmingham, Birmingham, Alabama 35244, USA |
| Reference | Zhu, F., Erlandsen, H., Ding, L., Li, J., Huang, Y., Zhou, M., Liang, X., Ma, J. and Wu, H., 2011. Structural and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesins. Journal of Biological Chemistry, 286(30), pp.27048-27057. |
| Corresponding Author | Department of Pediatric Dentistry and Microbiology, University of Alabama at Birmingham, Schools of Dentistry and Medicine, Birmingham, Alabama 35294, USA |
| Reference | Zhu, F., Zhang, H., Yang, T., Haslam, S.M., Dell, A. and Wu, H., 2016. Engineering and dissecting the glycosylation pathway of a streptococcal serine-rich repeat adhesin. Journal of Biological Chemistry, 291(53), pp.27354-27363. |
| Corresponding Author | Department of Pediatric Dentistry and Microbiology, University of Alabama at Birmingham, Schools of Dentistry and Medicine, Birmingham, Alabama 35294, USA |
| Reference | Zhu, F., Zhang, H., Yang, T., Haslam, S.M., Dell, A. and Wu, H., 2016. Engineering and dissecting the glycosylation pathway of a streptococcal serine-rich repeat adhesin. Journal of Biological Chemistry, 291(53), pp.27354-27363. |
| Corresponding Author | Department of Life Sciences, Imperial College London, London SW7 2AZ, United Kingdom |