ProGT117 (GT) Home -> ProGTdb -> Search ProGT_Main -> Display data Selected ID ProGT117 (GT) ProGT1 (PilO) ProGT2 (Alpha-toxin) ProGT3 (Toxin A) ProGT4 (Toxin B) ProGT5 (TcsL) ProGT6 (TcsL 82) ProGT7 (TcsL 9048) ProGT8 (Aah) ProGT9 (PglB) ProGT10 (PglB) ProGT11 (TibC) ProGT12 (Rv1002c) ProGT13 (AglB) ProGT14 (Pmt) ProGT15 (AglB) ProGT16 (AglB) ProGT17 (PglL) ProGT18 (PseD) ProGT19 (Lgt1) ProGT20 (GmaR) ProGT21 (PglO) ProGT22 (TcdBF/TcdB1470) ProGT23 (AglB) ProGT24 (PglL) ProGT25 (PglL) ProGT26 (TfpW) ProGT27 (Lgt2) ProGT28 (Lgt3) ProGT29 (Gap1) ProGT30 (Gap3) ProGT31 (XcOGT) ProGT32 (GT) ProGT33 (GtfA) ProGT34 (GtfB) ProGT35 (Pmt) ProGT36 (PglB) ProGT37 (Gtf1) ProGT38 (Gtf2) ProGT39 (HMW1C) ProGT40 (PglB1) ProGT41 (NGT) ProGT42 (ApNGT) ProGT43 (NGT) ProGT44 (NGT) ProGT45 (TpeL) ProGT46 (SunS) ProGT47 (ClPglB) ProGT48 (DdPglB) ProGT49 (PglA) ProGT50 (PglA) ProGT51 (AglB) ProGT52 (PglLBt) ProGT53 (AglB) ProGT54 (Maf1) ProGT55 (PglLAb) ProGT56 (PglB) ProGT57 (PglLVc) ProGT58 (TfpO) ProGT59 (WsfB) ProGT60 (AglB) ProGT61 (Pmt) ProGT62 (PimE) ProGT63 (NleB1) ProGT64 (TcsH) ProGT65 (ThuS) ProGT66 (SdgA) ProGT67 (SdgB) ProGT68 (PaTox) ProGT69 (GtfA) ProGT70 (GtfB) ProGT71 (PglLBc) ProGT72 (Tot/AglB) ProGT73 (STT3) ProGT74 (FilmQ) ProGT75 (GtfA) ProGT76 (GtfB) ProGT77 (GtfA) ProGT78 (GtfB) ProGT79 (BAHTCr) ProGT80 (AglB) ProGT81 (TcnA) ProGT82 (TcdB-CD196) ProGT83 (PglLADP1) ProGT84 (PglLComP) ProGT85 (TfpOM2) ProGT86 (PglLM2) ProGT87 (HMW1CAa) ProGT88 (HMW1CKk) ProGT89 (CcPglB) ProGT90 (PglB) ProGT91 (PglB) ProGT92 (PglB) ProGT93 (PglB) ProGT94 (PglB) ProGT95 (CuPglB) ProGT96 (DgPglB) ProGT97 (DvPglB) ProGT98 (PglB) ProGT99 (PglB) ProGT100 (PglB) ProGT101 (TtOGT) ProGT102 (SO_2329 (EarP)/ Efp-associated protein o ProGT103 (EarP) ProGT104 (PglLRs) ProGT105 (SeOGT) ProGT106 (SseK3) ProGT107 (PAV_2c01630) ProGT108 (PAV_2c01640) ProGT109 (EarP) ProGT110 (DfdPglB) ProGT111 (NtPglB) ProGT112 (SlPglB) ProGT113 (Gtf1) ProGT114 (Gtf2) ProGT115 (GT1) ProGT116 (EntS) ProGT117 (GT) ProGT118 (EarP) ProGT119 (Maf) ProGT120 (PgfS) ProGT121 (EarP) ProGT122 (AaNGT) [] Compare ID ProGT1 (PilO) ProGT2 (Alpha-toxin) ProGT3 (Toxin A) ProGT4 (Toxin B) ProGT5 (TcsL) ProGT6 (TcsL 82) ProGT7 (TcsL 9048) ProGT8 (Aah) ProGT9 (PglB) ProGT10 (PglB) ProGT11 (TibC) ProGT12 (Rv1002c) ProGT13 (AglB) ProGT14 (Pmt) ProGT15 (AglB) ProGT16 (AglB) ProGT17 (PglL) ProGT18 (PseD) ProGT19 (Lgt1) ProGT20 (GmaR) ProGT21 (PglO) ProGT22 (TcdBF/TcdB1470) ProGT23 (AglB) ProGT24 (PglL) ProGT25 (PglL) ProGT26 (TfpW) ProGT27 (Lgt2) ProGT28 (Lgt3) ProGT29 (Gap1) ProGT30 (Gap3) ProGT31 (XcOGT) ProGT32 (GT) ProGT33 (GtfA) ProGT34 (GtfB) ProGT35 (Pmt) ProGT36 (PglB) ProGT37 (Gtf1) ProGT38 (Gtf2) ProGT39 (HMW1C) ProGT40 (PglB1) ProGT41 (NGT) ProGT42 (ApNGT) ProGT43 (NGT) ProGT44 (NGT) ProGT45 (TpeL) ProGT46 (SunS) ProGT47 (ClPglB) ProGT48 (DdPglB) ProGT49 (PglA) ProGT50 (PglA) ProGT51 (AglB) ProGT52 (PglLBt) ProGT53 (AglB) ProGT54 (Maf1) ProGT55 (PglLAb) ProGT56 (PglB) ProGT57 (PglLVc) ProGT58 (TfpO) ProGT59 (WsfB) ProGT60 (AglB) ProGT61 (Pmt) ProGT62 (PimE) ProGT63 (NleB1) ProGT64 (TcsH) ProGT65 (ThuS) ProGT66 (SdgA) ProGT67 (SdgB) ProGT68 (PaTox) ProGT69 (GtfA) ProGT70 (GtfB) ProGT71 (PglLBc) ProGT72 (Tot/AglB) ProGT73 (STT3) ProGT74 (FilmQ) ProGT75 (GtfA) ProGT76 (GtfB) ProGT77 (GtfA) ProGT78 (GtfB) ProGT79 (BAHTCr) ProGT80 (AglB) ProGT81 (TcnA) ProGT82 (TcdB-CD196) ProGT83 (PglLADP1) ProGT84 (PglLComP) ProGT85 (TfpOM2) ProGT86 (PglLM2) ProGT87 (HMW1CAa) ProGT88 (HMW1CKk) ProGT89 (CcPglB) ProGT90 (PglB) ProGT91 (PglB) ProGT92 (PglB) ProGT93 (PglB) ProGT94 (PglB) ProGT95 (CuPglB) ProGT96 (DgPglB) ProGT97 (DvPglB) ProGT98 (PglB) ProGT99 (PglB) ProGT100 (PglB) ProGT101 (TtOGT) ProGT102 (SO_2329 (EarP)/ Efp-associated protein o ProGT103 (EarP) ProGT104 (PglLRs) ProGT105 (SeOGT) ProGT106 (SseK3) ProGT107 (PAV_2c01630) ProGT108 (PAV_2c01640) ProGT109 (EarP) ProGT110 (DfdPglB) ProGT111 (NtPglB) ProGT112 (SlPglB) ProGT113 (Gtf1) ProGT114 (Gtf2) ProGT115 (GT1) ProGT116 (EntS) ProGT117 (GT) ProGT118 (EarP) ProGT119 (Maf) ProGT120 (PgfS) ProGT121 (EarP) ProGT122 (AaNGT) [] Compare ID ProGT1 (PilO) ProGT2 (Alpha-toxin) ProGT3 (Toxin A) ProGT4 (Toxin B) ProGT5 (TcsL) ProGT6 (TcsL 82) ProGT7 (TcsL 9048) ProGT8 (Aah) ProGT9 (PglB) ProGT10 (PglB) ProGT11 (TibC) ProGT12 (Rv1002c) ProGT13 (AglB) ProGT14 (Pmt) ProGT15 (AglB) ProGT16 (AglB) ProGT17 (PglL) ProGT18 (PseD) ProGT19 (Lgt1) ProGT20 (GmaR) ProGT21 (PglO) ProGT22 (TcdBF/TcdB1470) ProGT23 (AglB) ProGT24 (PglL) ProGT25 (PglL) ProGT26 (TfpW) ProGT27 (Lgt2) ProGT28 (Lgt3) ProGT29 (Gap1) ProGT30 (Gap3) ProGT31 (XcOGT) ProGT32 (GT) ProGT33 (GtfA) ProGT34 (GtfB) ProGT35 (Pmt) ProGT36 (PglB) ProGT37 (Gtf1) ProGT38 (Gtf2) ProGT39 (HMW1C) ProGT40 (PglB1) ProGT41 (NGT) ProGT42 (ApNGT) ProGT43 (NGT) ProGT44 (NGT) ProGT45 (TpeL) ProGT46 (SunS) ProGT47 (ClPglB) ProGT48 (DdPglB) ProGT49 (PglA) ProGT50 (PglA) ProGT51 (AglB) ProGT52 (PglLBt) ProGT53 (AglB) ProGT54 (Maf1) ProGT55 (PglLAb) ProGT56 (PglB) ProGT57 (PglLVc) ProGT58 (TfpO) ProGT59 (WsfB) ProGT60 (AglB) ProGT61 (Pmt) ProGT62 (PimE) ProGT63 (NleB1) ProGT64 (TcsH) ProGT65 (ThuS) ProGT66 (SdgA) ProGT67 (SdgB) ProGT68 (PaTox) ProGT69 (GtfA) ProGT70 (GtfB) ProGT71 (PglLBc) ProGT72 (Tot/AglB) ProGT73 (STT3) ProGT74 (FilmQ) ProGT75 (GtfA) ProGT76 (GtfB) ProGT77 (GtfA) ProGT78 (GtfB) ProGT79 (BAHTCr) ProGT80 (AglB) ProGT81 (TcnA) ProGT82 (TcdB-CD196) ProGT83 (PglLADP1) ProGT84 (PglLComP) ProGT85 (TfpOM2) ProGT86 (PglLM2) ProGT87 (HMW1CAa) ProGT88 (HMW1CKk) ProGT89 (CcPglB) ProGT90 (PglB) ProGT91 (PglB) ProGT92 (PglB) ProGT93 (PglB) ProGT94 (PglB) ProGT95 (CuPglB) ProGT96 (DgPglB) ProGT97 (DvPglB) ProGT98 (PglB) ProGT99 (PglB) ProGT100 (PglB) ProGT101 (TtOGT) ProGT102 (SO_2329 (EarP)/ Efp-associated protein o ProGT103 (EarP) ProGT104 (PglLRs) ProGT105 (SeOGT) ProGT106 (SseK3) ProGT107 (PAV_2c01630) ProGT108 (PAV_2c01640) ProGT109 (EarP) ProGT110 (DfdPglB) ProGT111 (NtPglB) ProGT112 (SlPglB) ProGT113 (Gtf1) ProGT114 (Gtf2) ProGT115 (GT1) ProGT116 (EntS) ProGT117 (GT) ProGT118 (EarP) ProGT119 (Maf) ProGT120 (PgfS) ProGT121 (EarP) ProGT122 (AaNGT) [] Compare ID ProGT1 (PilO) ProGT2 (Alpha-toxin) ProGT3 (Toxin A) ProGT4 (Toxin B) ProGT5 (TcsL) ProGT6 (TcsL 82) ProGT7 (TcsL 9048) ProGT8 (Aah) ProGT9 (PglB) ProGT10 (PglB) ProGT11 (TibC) ProGT12 (Rv1002c) ProGT13 (AglB) ProGT14 (Pmt) ProGT15 (AglB) ProGT16 (AglB) ProGT17 (PglL) ProGT18 (PseD) ProGT19 (Lgt1) ProGT20 (GmaR) ProGT21 (PglO) ProGT22 (TcdBF/TcdB1470) ProGT23 (AglB) ProGT24 (PglL) ProGT25 (PglL) ProGT26 (TfpW) ProGT27 (Lgt2) ProGT28 (Lgt3) ProGT29 (Gap1) ProGT30 (Gap3) ProGT31 (XcOGT) ProGT32 (GT) ProGT33 (GtfA) ProGT34 (GtfB) ProGT35 (Pmt) ProGT36 (PglB) ProGT37 (Gtf1) ProGT38 (Gtf2) ProGT39 (HMW1C) ProGT40 (PglB1) ProGT41 (NGT) ProGT42 (ApNGT) ProGT43 (NGT) ProGT44 (NGT) ProGT45 (TpeL) ProGT46 (SunS) ProGT47 (ClPglB) ProGT48 (DdPglB) ProGT49 (PglA) ProGT50 (PglA) ProGT51 (AglB) ProGT52 (PglLBt) ProGT53 (AglB) ProGT54 (Maf1) ProGT55 (PglLAb) ProGT56 (PglB) ProGT57 (PglLVc) ProGT58 (TfpO) ProGT59 (WsfB) ProGT60 (AglB) ProGT61 (Pmt) ProGT62 (PimE) ProGT63 (NleB1) ProGT64 (TcsH) ProGT65 (ThuS) ProGT66 (SdgA) ProGT67 (SdgB) ProGT68 (PaTox) ProGT69 (GtfA) ProGT70 (GtfB) ProGT71 (PglLBc) ProGT72 (Tot/AglB) ProGT73 (STT3) ProGT74 (FilmQ) ProGT75 (GtfA) ProGT76 (GtfB) ProGT77 (GtfA) ProGT78 (GtfB) ProGT79 (BAHTCr) ProGT80 (AglB) ProGT81 (TcnA) ProGT82 (TcdB-CD196) ProGT83 (PglLADP1) ProGT84 (PglLComP) ProGT85 (TfpOM2) ProGT86 (PglLM2) ProGT87 (HMW1CAa) ProGT88 (HMW1CKk) ProGT89 (CcPglB) ProGT90 (PglB) ProGT91 (PglB) ProGT92 (PglB) ProGT93 (PglB) ProGT94 (PglB) ProGT95 (CuPglB) ProGT96 (DgPglB) ProGT97 (DvPglB) ProGT98 (PglB) ProGT99 (PglB) ProGT100 (PglB) ProGT101 (TtOGT) ProGT102 (SO_2329 (EarP)/ Efp-associated protein o ProGT103 (EarP) ProGT104 (PglLRs) ProGT105 (SeOGT) ProGT106 (SseK3) ProGT107 (PAV_2c01630) ProGT108 (PAV_2c01640) ProGT109 (EarP) ProGT110 (DfdPglB) ProGT111 (NtPglB) ProGT112 (SlPglB) ProGT113 (Gtf1) ProGT114 (Gtf2) ProGT115 (GT1) ProGT116 (EntS) ProGT117 (GT) ProGT118 (EarP) ProGT119 (Maf) ProGT120 (PgfS) ProGT121 (EarP) ProGT122 (AaNGT) [] Search Display Criteria all All Organism Gene Information Genome Information Protein Name Glycan Information Acceptor Subtrate Information Litrature ProGT ID ProGT117 (GT) Organism Information Organism NameStreptococcus sanguinis (strain SK36) Clinical ImplicationPathogenicDomainBacteriaPhylumFirmicutesClassificationFamily: StreptococcaceaeOrder: LactobacillalesClass: Bacilli (or Firmibacteria)Division or phylum: "Firmicutes"Taxonomic ID (NCBI)388919 Genome Information Gene BankCP000387 EMBLCP000387 Gene Information Gene NameSSA_0830 NCBI Gene ID4806104 Protein information Protein NameGlycosyltransferase, putative UniProtKB/ SwissProt IDA3CM53 NCBI Ref SeqWP_011836740.1 UniProtKB Sequence>tr|A3CM53|A3CM53_STRSV Glycosyltransferase, putative OS=Streptococcus sanguinis (strain SK36) OX=388919 GN=SSA_0830 PE=1 SV=1 MKTIVLVGDQAYQEQVSTTIKSILYYNKNVKIYVFNQGLSDEWFRDFNELVEQLDSELVN ISLDQVTISPEWLTQDHISSATYARYFIPQFVAEGRVLYLDSDLVVNRDLQPLFDIPLEG KLVAAVGDAGGYGFNAGVLLIDNRSWKERELQESFIKETDRIMGLVQSGQMEDFNGDQTV LNHVLAQDWLPLDKIYNLQVGHDLVAFYSGWNGHFELDQEPLIIHYTTFRKPWNSEVSYR YRQLWWDFQALSLEEILAHHRGEFEMPDRWEKAALNCMLLTDVQELEQIEFLAQSLPRVD FHIACYTEMGAYLQSLNQYENIHLYPQVIHAVLDELIDKCQVYLDIHHGSEHYELSSRFK ALGKPVLAFDNTKKNEKEELVYPHEHPQEMVRKLRSLMKKEKPQAFRAVVLAANAAYSEQ VLTTIKSIVCHNRFIKFYVINSDFPTEWFVSMRKKLAKLDCQIVNARVDGSHISQYKTNI HYSVFLRYFTATFVEEDQALYLDCDIVVTRDLSEIFAVDLGSYPLGAVRDLGGEVYFGEQ IFNSGVLLINVNYWRENDIAGQLIEMTDNLHDKVTQDDQSILNMLFENRWMELPFAYNCI TLHTTFSDYEPEKGLYPPVIHYLTERKPWKEYTQSIYREVWWFYQGLDWSDMQEPVGALT QKMVEGEDGPSLSCLVYTYSCDLMHINYLIQALPACHFYIAAPVVVAEPITRLLQYPNVS VSSDIAGIPALLESLEAKSQLLLDINAGDEVGDIIARFKSAGKPVFAFDSTVHGQQGQEV FPADNPEVMVQAIEKLGLAEPEERQISVLSINQSLDYLLEKGASVVRFGDGEMDLVAGRS IVYQDFDPELSARLREIMSMESDERLMVCLPDVFTGLERYSIDAQNFWSLNHLPHFLEKY KNICRAPWYGSTFISRPYIDLEDKTPSVGYFAKLKQLWQDKDLLIVEGLTSRSGVGNDLF DGARSIKRIICPSRNAYSKLEAIKQAVREHADNRLILTMLGPTAKVLVYDLVQEGYRALD IGHIDSEYEWFQMGASHKVKLSHKHTAEHNFDQDIEFRDDQAYDSQIVANLAQE EMBL CDSABN44258.1 Sequence length1074 AA String388919.SSA_0830 PDB ID 5V4A Glycosyltransferase Information CAZY FamilyGT8 Glycan Information Litrature Year Of Validation2017 Reference Zhang, H., Zhu, F., Yang, T., Ding, L., Zhou, M., Li, J., Haslam, S.M., Dell, A., Erlandsen, H. & Wu, H. (2014). The highly conserved domain of unknown function 1792 has a distinct glycosyltransferase fold. Nature communications, 5, 4339.Authors Zhang, H., Zhu, F., Yang, T., Ding, L., Zhou, M., Li, J., Haslam, S.M., Dell, A., Erlandsen, H. & Wu, H. Corresponding Author Wu, H. ProCGP (Characterized Glycoproteins) is a compilation of bacterial and archaeal glycoproteins for which at least one site of glycosylation is validated experimentally using one or multiple methods like, site directed mutagenesis, Edman degradation, mass spectroscopy etc. Each entry in ProCGP has a unique identifier ProGP ID. ProCGP search allows user to seek experimentally verified information about an entry selected by using four different search criteria. ProUGP (Uncharacterized Glycoproteins) is a compilation of bacterial and archaeal glycoproteins that are known to be glycosylated from experiments like PAS staining, abberant migration on SDS-PAGE, lectin binding etc. but yet not mapped for the precise position of glycosylated residue (s) in a protein sequence. Each entry in ProUGP has a unique identifier ProGP ID. ProUGP search provides manually curated, published information about selected entry in ProUGP. Choose Search Criteria Choose ProGP ID Organism Protein Name UniProtKB/SwissProt ID Select Value Select Value Choose Display Criteria All Organism Gene Information Genome Information Protein Information Glycosylation Status Glycan Information Protein Glycosylation linked (PGL) gene(s) Accessory PGL Gene(s) Literature ProGT_Main (Prokaryotic Protein Glycosyl Transferases): is a compilation of bacterial and archaeal protein glycosyltransferases for which at least one genetic or biochemical evidence of glycosyltransferase activity is validated in the published literature. Each entry in ProGT_Main has a unique identifier ProGT ID. ProGT_Main search allows user to seek experimentally verified information about an entry selected by using four different search criteria ProGT_Accessory (Accessory Protein or enzyme to Prokaryotic Protein Glycosyl Transferases): is a compilation of such bacterial and archaeal proteins/enzyme that have miscellaneous accessory roles in a given protein glycosylation pathway of a characterized protein glycosyltransferases compiled in ProGT_Main. The qualifying criteria is at least one known genetic or biochemical evidence of accessory function, in literature. Each entry in ProGT_Accessory has a unique identifier ProGT ID. ProGT_Accessory search provides manually curated, published information about selected entry. Choose Search Criteria Choose ProGT ID Organism Protein Name UniProtKB/SwissProt ID Select Value Search Display Criteria All Organism Gene Information Genome Information Protein Name Glycan Information Acceptor Subtrate Information Literature Search Location choose Database Choose Main Accessory ProCGP ProUGP Enter ID. #ex1