| Organism Information |
| Organism Name | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Clinical Implication | Pathogenic |
| Domain | Bacteria |
| Phylum | Actinobacteria |
| Classification | Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria" |
| Taxonomic ID (NCBI) | 83332 |
| Genome Information |
| Gene Bank | AL123456 |
| EMBL | AL123456 |
| Gene Information |
| Gene Name | pmt |
| NCBI Gene ID | 887882 |
| Protein information |
| Protein Name | Rv1002c |
| UniProtKB/ SwissProt ID | P9WN05 |
| NCBI Ref Seq | NP_215518.1 |
| UniProtKB Sequence | >sp|P9WN05|PMT_MYCTU Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pmt PE=1 SV=2
MTARPPESCVLAKDRPEEPVVPVVSPGPLVPVADFGPLDRLRGWIVTGLITLLATVTRFL
NLGSLTDAGTPIFDEKHYAPQAWQVLNNHGVEDNPGYGLVVHPPVGKQLIAIGEAIFGYN
GFGWRFTGALLGVVLVALVVRIVRRISRSTLVGAIAGVLLICDGVSFVTARTALLDGFLT
FFVVAAFGALIVDRDQVRERMHIALLAGRSAATVWGPRVGVRWWRFGAGVLLGLACATKW
SGVYFVLFFGAMALAFDVAARRQYQVQRPWLGTVRRDVLPSGYALGLIPFAVYLATYAPW
FASETAIDRHAVGQAVGRNSVVPLPDAVRSLWHYTAKAFHFHAGLTNSAGNYHPWESKPW
TWPMSLRPVLYAIDQQDVAGCGAQSCVKAEMLVGTPAMWWLAVPVLAYAGWRMFVRRDWR
YAVVLVGYCAGWLPWFADIDRQMYFFYAATMAPFLVMGISLVLGDILYHPGQGSERRTLG
LIVVCCYVALVVTNFAWLYPVLTGLPISQQTWNLEIWLPSWR
|
| EMBL CDS | CCP43752.1 |
| Sequence length | 503 AA |
| Subcellular Location | Membrane |
| Function in Native Organism | 1) Rv1002c is O-mannosyltransferase transfer the mannose to the alanine proline-rich protein Apa. |
| String | 83332.Rv1002c. |
| Potential Application | 1) O-mannosylated and other glycoproteins are present on the cell surface of M. TB and are involved in interaction with host cell during infection, this protein glycosyltransferase may be useful in designing of novel drug targets. |
| Additional Information | 1) Mycobacterial protein O-mannosylation occurs by a similar mechanism to that in eukaryotes. |
| Glycosyltransferase Information |
| Glycosylation Type | O- (Ser/Thr) linked |
| CAZY Family | GT39 |
| EC Number (BRENDA) | 2.4.1.- |
| Donor Type | Lipid linked sugars |
| Donor Specificity | Polyprenol phosphate-Mannose |
| Accessory GT ID | ProGT12.1 |
| Glycan Information |
| Glycan transferred | Monosaccharide (Man)Â |
| Method of Glycan Indentification | LC-ESI-MS/MS |
| Acceptor Subtrate Information |
| Acceptor Substrate name | Apa |
| ProGPdb ID | ProGP51 |
| Acceptor Substrate name | SodC |
| ProGPdb ID | ProGP189 |
| Litrature |
| Year Of Validation | 2005Â |
| Reference | VanderVen, B. C., Harder, J. D., Crick, D. C., & Belisle, J. T. (2005). Export-mediated assembly of mycobacterial glycoproteins parallels eukaryotic pathways. Science, 309(5736), 941-943.
|
| Authors | VanderVen, B. C., Harder, J. D., Crick, D. C., & Belisle, J. T.
|
| Research groups | Mycobacteria Research Laboratories, Department of Microbiology, Immunology, and Pathology, Colorado State University, Fort Collins, CO 80523-1682, USA.
|
| Corresponding Author | Belisle, J. T.
|
| Contacts | Mycobacteria Research Laboratories, Department of Microbiology, Immunology, and Pathology, Colorado State University, Fort Collins, CO 80523-1682, USA.
|
| Reference | Liu, C.F., Tonini, L., Malaga, W., Beau, M., Stella, A., Bouyssié, D., Jackson, M.C., Nigou, J., Puzo, G., Guilhot, C. & Burlet-Schiltz, O.(2013). Bacterial protein-O-mannosylating enzyme is crucial for virulence of Mycobacterium tuberculosis. Proceedings of the National Academy of Sciences, p.201219704.
|
| Authors | Liu, C.F., Tonini, L., Malaga, W., Beau, M., Stella, A., Bouyssié, D., Jackson, M.C., Nigou, J., Puzo, G., Guilhot, C. & Burlet-Schiltz, O.
|
| Research groups | Scientific Research National Center, Institute of Pharmacology and Structural Biology, F-31077 Toulouse, France.
|
| Corresponding Author | Burlet-Schiltz, O.
|
| Contacts | Scientific Research National Center, Institute of Pharmacology and Structural Biology, F-31077 Toulouse, France.
|
| Reference | Córdova-Dávalos, L. E., Espitia, C., González-Cerón, G., Arreguín-Espinosa, R., Soberón-Chávez, G., & Servín-González, L. (2014). Lipoprotein N-acyl transferase (Lnt1) is dispensable for protein O-mannosylation by Streptomyces coelicolor. FEMS microbiology letters, 350(1), 72-82.
|
| Authors | Córdova-Dávalos, L. E., Espitia, C., González-Cerón, G., Arreguín-Espinosa, R., Soberón-Chávez, G., & Servín-González, L.
|
| Research groups | Department of Molecular Biology and Biotechnology, Institute of Biomedical Research, National Autonomous University of Mexico, Ciudad Universitaria, Mexico City, Mexico City.
|
| Corresponding Author | Servín-González, L.
|
| Contacts | Department of Molecular Biology and Biotechnology, Institute of Biomedical Research, National Autonomous University of Mexico, Ciudad Universitaria, Mexico City, Mexico City.
|
