ProGT33 (GtfA)
| ProGT ID | ProGT33 (GtfA) |
| Organism Information | |
| Organism Name | Streptococcus agalactiae serotype III (strain NEM316) |
| Clinical Implication | Pathogenic |
| Domain | Bacteria |
| Classification | Phylum : Firmicutes Class : Bacilli Orders : Lactobacillales Family : Streptococcaceae Genus : Streptococcus Species : agalactiae Strain : NEM316 |
| Taxonomic ID (NCBI) | 211110 |
| Genome Information | |
| Gene Bank | NC_004368.1 |
| EMBL | AL766851 |
| Gene Information | |
| Gene Name | gbs1515 |
| NCBI Reference Sequence | CAD47174 |
| Protein information | |
| UniProtKB/ SwissProt ID | Q8E487 |
| NCBI Ref Seq | WP_000728848.1 |
| UniProtKB Sequence | >tr|Q8E487|Q8E487_STRA3 Uncharacterized protein OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gbs1515 PE=4 SV=1 MKKKNLLQESINKRLSEERYQIPKEKREKKRFDMQLILIISILIGLIMSIIGIIRFFLTY SS |
| EMBL CDS | CAD47174.1 |
| Sequence length | 62 AA |
| Subcellular Location | Membrane (Integral component of membrane) |
| String | 211110.gbs1515. |
| Glycosyltransferase Information | |
| Glycosylation Type | O- (Ser/Thr) linked |
| EC Number (BRENDA) | 2.4.1.- |
| Mechanism of Glycan Transfer | Sequential |
| Donor Type | GlcNAc and sialic acid |
| Donor Specificity | Nucleotide activated sugars |
| Accessory GT ID | ProGT33.1,ProGT33.2,ProGT33.3,ProGT33.4,ProGT33.5,ProGT33.6 |
| Glycan Information | |
| Method of Glycan Indentification | LC-MS/MS (ETD, CID and HCD) |
| Experimental_strategies | In vivo |
| Acceptor Subtrate Information | |
| Acceptor Substrate name | Srr1 |
| ProGPdb ID | ProGP316 |
| Litrature | |
| Year Of Validation | 2009 |
| Reference | Mistou, M.Y., Dramsi, S., Brega, S., Poyart, C. and Trieu-Cuot, P., 2009. Molecular dissection of the secA2 locus of group B Streptococcus reveals that glycosylation of the Srr1 LPXTG protein is required for full virulence. Journal of bacteriology, 191(13), pp.4195-4206. |
| Corresponding Author | Institut Pasteur, Biological Unit of Gram-Positive Pathogenic Bacteria, URA CNRS 2172, Paris Cedex 15, France. |
| Reference | Chaze, T., Guillot, A., Valot, B., Langella, O., Chamot-Rooke, J., Di Guilmi, A.M., Trieu-Cuot, P., Dramsi, S. and Mistou, M.Y., 2014. O-Glycosylation of the N-terminal region of the serine-rich adhesin Srr1 of Streptococcus agalactiae explored by mass spectrometry. Molecular & Cellular Proteomics, 13(9), pp.2168-2182. |
| Corresponding Author | INRA, MICALIS UMR-1319, 78352 Jouy-en-Josas cedex, France |