ProGT33 (GtfA)
ProGT ID | ProGT33 (GtfA) |
Organism Information | |
Organism Name | Streptococcus agalactiae serotype III (strain NEM316) |
Clinical Implication | Pathogenic |
Domain | Bacteria |
Phylum | Firmicutes |
Classification | Family: Streptococcaceae Order: Lactobacillales Class: Bacilli (or Firmibacteria) Division or phylum: "Firmicutes" |
Taxonomic ID (NCBI) | 211110 |
Genome Information | |
Gene Bank | NC_004368.1 |
EMBL | AL766851 |
Gene Information | |
Gene Name | gbs1515 |
NCBI Reference Sequence | CAD47174 |
Protein information | |
UniProtKB/ SwissProt ID | Q8E487 |
NCBI Ref Seq | WP_000728848.1 |
UniProtKB Sequence | >tr|Q8E487|Q8E487_STRA3 Uncharacterized protein OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gbs1515 PE=4 SV=1 MKKKNLLQESINKRLSEERYQIPKEKREKKRFDMQLILIISILIGLIMSIIGIIRFFLTY SS |
EMBL CDS | CAD47174.1 |
Sequence length | 62 AA |
Subcellular Location | Membrane (Integral component of membrane) |
String | 211110.gbs1515. |
Glycosyltransferase Information | |
Glycosylation Type | O- (Ser/Thr) linked |
EC Number (BRENDA) | 2.4.1.- |
Mechanism of Glycan Transfer | Sequential |
Donor Type | Nucleotide activated sugars |
Donor Specificity | GlcNAc and sialic acid |
Accessory GT ID | ProGT33.1ProGT33.2ProGT33.3ProGT33.4ProGT33.5ProGT33.6 |
Glycan Information | |
Method of Glycan Indentification | LC-MS/MS (ETD, CID and HCD) |
Experimental_strategies | In vivo |
Acceptor Subtrate Information | |
Acceptor Substrate name | Srr1 |
ProGPdb ID | ProGP316 |
Litrature | |
Year Of Validation | 2009Â |
Reference | Mistou, M. Y., Dramsi, S., Brega, S., Poyart, C., & Trieu-Cuot, P. (2009). Molecular dissection of the secA2 locus of group B Streptococcus reveals that glycosylation of the Srr1 LPXTG protein is required for full virulence. Journal of bacteriology, 191(13), 4195-4206. |
Authors | Mistou, M. Y., Dramsi, S., Brega, S., Poyart, C., & Trieu-Cuot, P. |
Research groups | Institut Pasteur, Biological Unit of Gram-Positive Pathogenic Bacteria, URA CNRS 2172, Paris Cedex 15, France. |
Corresponding Author | Trieu-Cuot, P. |
Contacts | Institut Pasteur, Biological Unit of Gram-Positive Pathogenic Bacteria, URA CNRS 2172, Paris Cedex 15, France. |
Reference | Chaze, T., Guillot, A., Valot, B., Langella, O., Chamot-Rooke, J., Di Guilmi, A.M., Trieu-Cuot, P., Dramsi, S. & Mistou, M. Y. (2014). O-glycosylation of the N-terminal region of the serine-rich adhesin Srr1 of Streptococcus agalactiae explored by mass spectrometry. Molecular & Cellular Proteomics, mcp-M114. |
Authors | Chaze, T., Guillot, A., Valot, B., Langella, O., Chamot-Rooke, J., Di Guilmi, A.M., Trieu-Cuot, P., Dramsi, S. & Mistou, M. Y. |
Research groups | 1 INRA MICALIS UMR 1319, 78352 Jouy-en-Josas cedex, France; AgroParisTech, MICALIS UMR 1319, 78352 Jouy-en-Josas cedex, France; Shepherd Institute, Mass Spectrometry and Proteomics Structural Unit, 28 rue du Dr. Roux, 75015 Paris, France
2 INRA, PAPPSO, MICALIS UMR-1319, 78352 Jouy en Josas cedex, France
3INRA, PAPPSO, Plant Genetics UMR-320, Ferme du Moulon, 91190 Gif sur Yvette, France;
4 Shepherd Institute, Mass Spectrometry and Proteomics Structural Unit, 28 rue du Dr. Roux, 75015 Paris, France; CNRS UMR 3528, Pasteur Institute, 28 rue du Dr. Roux, 75015 Paris, Francee
5 CEA, Institute of Structural Biology Jean-Pierre Ebel, F-38027 Grenoble, France
6 Institut Pasteur Bacteria Biology of Pathogenic Gram +, 28, rue du Dr Roux, 75015 Paris, France; Centre National Center for Scientific Research, CNRS ERL3526, Paris, France
7 INRA MICALIS UMR 1319, 78352 Jouy-en-Josas cedex, France |
Corresponding Author | Mistou, M. Y. |
Contacts | INRA, MICALIS UMR-1319, 78352 Jouy-en-Josas cedex, France |