ProGT41 (NGT)
ProGT ID | ProGT41 (NGT) |
Organism Information | |
Organism Name | Actinobacillus pleuropneumoniae |
Clinical Implication | Pathogenic |
Domain | Bacteria |
Phylum | Proteobacteria |
Classification | Family: Pasteurellaceae Order: Pasteurellales Class: Gammaproteobacteria Phylum: Proteobacteria |
Taxonomic ID (NCBI) | 715 |
Genome Information | |
Gene Bank | CP022715.1 |
EMBL | CP022715.1 |
Gene Information | |
Gene Name | appser1_17560 |
Protein information | |
Protein Name | NGTÂ |
UniProtKB/ SwissProt ID | A0A223MD76 |
NCBI Ref Seq | WP_005599032.1 |
UniProtKB Sequence | >tr|A0A223MD76|A0A223MD76_ACTPL UDP-glucose:protein N-beta-glucosyltransferase OS=Actinobacillus pleuropneumoniae OX=715 GN=CHY23_00708 PE=4 SV=1 MENENKPNVANFEAAVAAKDYEKACSELLLILSQLDSNFGGIQEIEFEYPAQLQDLEQEK IVYFCTRMATAITTLFSDPVLEISDLGVQRFLVYQRWLALIFASSPFVNADHILQTYNRE PNRKNSLEIHLDSSKSSLIKFCILYLPESNVNLNLDVMWNISPELCASLCFALQSPRFIG TSTAFNKRATILQWFPRHLDQLKNLNNIPSAISHDVYMHCSYDTSVNKHDVKRALNHVIR RHIESEYGWKDRDVAHIGYRNNKPVMVVLLEHFHSAHSIYRTHSTSMIAAREHFYLIGLG SPSVDQAGQEVFDEFHLVAGDNMKQKLEFIRSVCESNGAAIFYMPSIGMDMTTIFASNTR LAPIQAIALGHPATTHSDFIEYVIVEDDYVGSEECFSETLLRLPKDALPYVPSALAPEKV DYLLRENSEVVNIGIASTTMKLNPYFLEALKAIRDRAKVKVHFHFALGQSNGITHPYVER FIKSYLGDSATAHPHSPYHQYLRILHNCDMMVNPFPFGNTNGIIDMVTLGLVGVCKTGAE VHEHIDEGLFKRLGLPEWLIANTVDEYVERAVRLAENHQERLELRRYIIENNGLNTLFTG DPRPMGQVFLEKLNAFLKEN |
EMBL CDS | ASU15484 |
Sequence length | 620 AA |
Subcellular Location | Cytoplasm |
String | 228399.appser1_17560 |
PDB ID | 3Q3E 3Q3H 3Q3I |
Glycosyltransferase Information | |
Glycosylation Type | N- (Asn) linked |
CAZY Family | GT41 |
EC Number (BRENDA) | 2.4.1.- |
Mechanism of Glycan Transfer | Sequential |
Acceptor specificity Sequon_1 | Asn-Xaa-Ser/Thr |
Donor Type | Nucleotide activated sugars (UDP and GDP linked hexose) |
Donor Specificity | UDP-Glc and UDP-Gal ( UDP-Glc is preferred over UDP-Gal) |
Glycan Information | |
Glycan transferred | Monosaccharides (Glc and Gal)Â |
Method of Glycan Indentification | GlycoProfile III Fluorescent Glycoprotein Detection kit |
Experimental_strategies | In vitro and In vivo  |
Acceptor Subtrate Information | |
Acceptor Substrate name | HMW1ct |
ProGPdb ID | ProGP227 |
Litrature | |
Year Of Validation | 2010Â |
Reference | Choi, K. J., Grass, S., Paek, S., Geme III, J. W. S., & Yeo, H. J. (2010). The Actinobacillus pleuropneumoniae HMW1C-like glycosyltransferase mediates N-linked glycosylation of the Haemophilus influenzae HMW1 adhesin. PLoS One, 5(12), e15888. |
Authors | Choi, K. J., Grass, S., Paek, S., Geme III, J. W. S., & Yeo, H. J. |
Research groups | Department of Biology and Biochemistry, University of Houston, Houston, Texas, United States of America. |
Corresponding Author | Yeo, H. J. |
Contacts | Department of Biology and Biochemistry, University of Houston, Houston, Texas, United States of America |
Reference | Kawai, F., Grass, S., Kim, Y., Choi, K. J., St Geme, J. W., & Yeo, H. J. (2011). Structural insights into the glycosyltransferase activity of the Actinobacillus pleuropneumoniae HMW1C-like protein. Journal of Biological Chemistry, jbc-M111. |
Authors | Kawai, F., Grass, S., Kim, Y., Choi, K. J., St Geme, J. W., & Yeo, H. J. |
Research groups | Dept. of Biology and Biochemistry, University of Houston, Houston, Texas 77204. Tel.: 713-743-8377; Fax: 713-743-8351 |
Corresponding Author | Yeo, H. J. |
Contacts | Department of Biology and Biochemistry, University of Houston, Houston, Texas 77204. |
Reference | Song, Q., Wu, Z., Fan, Y., Song, W., Zhang, P., Wang, L., ... & Cheng, J. (2017). Production of homogeneous glycoprotein with multisite modifications by an engineered N-glycosyltransferase mutant. Journal of Biological Chemistry, 292(21), 8856-8863. |
Authors | Song, Q., Wu, Z., Fan, Y., Song, W., Zhang, P., Wang, L., ... & Cheng, J. |
Research groups | State Key Laboratory of Medicinal Chemical Biology and College of Pharmacy, Nankai University, Haihe Education Park, 38 Tongyan Road, Tianjin 300353, China and Department of Chemistry, Georgia State University, Atlanta, Georgia 30303 |
Corresponding Author | Cheng, J. |
Contacts | State Key Laboratory of Medicinal Chemical Biology and College of Pharmacy, Nankai University, Haihe Education Park, 38 Tongyan Road, Tianjin 300353, China |
Reference | Lomino, J. V., Naegeli, A., Orwenyo, J., Amin, M. N., Aebi, M., & Wang, L. X. (2013). A two-step enzymatic glycosylation of polypeptides with complex N-glycans. Bioorganic & medicinal chemistry, 21(8), 2262-2270. |
Authors | Lomino, J. V., Naegeli, A., Orwenyo, J., Amin, M. N., Aebi, M., & Wang, L. X. |
Research groups | Institute of Human Virology and Department of Biochemistry and Molecular Biology, University of Maryland School of Medicine, Baltimore, MD 21201, United States
Institute of Microbiology, Dept. of Biology, ETH Zürich, Wolfgang-Pauli-Str. 10, 8093 Zürich, Switzerland |
Corresponding Author | Wang, L. X. |
Contacts | Institute of Human Virology and Department of Biochemistry and Molecular Biology, University of Maryland School of Medicine, Baltimore, MD 21201, United States |
Reference | Xu, Y., Wu, Z., Zhang, P., Zhu, H., Zhu, H., Song, Q., ... & Cheng, J. (2017). A novel enzymatic method for synthesis of glycopeptides carrying natural eukaryotic N-glycans. Chemical Communications, 53(65), 9075-9077. |
Authors | Xu, Y., Wu, Z., Zhang, P., Zhu, H., Zhu, H., Song, Q., ... & Cheng, J. |
Research groups | State Key Laboratory of Medicinal Chemical Biology and College of Pharmacy, Nankai University, Haihe Education Park, 38 Tongyan Road, Tianjin 300353,
P. R. China
Department of Chemistry, Georgia State University, Atlanta, Georgia 30303, USA |
Corresponding Author | Cheng, J. |
Contacts | State Key Laboratory of Medicinal Chemical Biology and College of Pharmacy, Nankai University, Haihe Education Park, 38 Tongyan Road, Tianjin 300353, China |