ProGT79 (BAHTCr)
| ProGT ID | ProGT79 (BAHTCr) |
| Organism Information | |
| Organism Name | Citrobacter rodentium (strain ICC168) (Citrobacter freundii biotype 4280) |
| Clinical Implication | Pathogenic |
| Domain | Bacteria |
| Phylum | Proteobacteria |
| Classification | Family: Enterobacteriaceae Order: Enterobacteriales Class: Gammaproteobacteria Division or phylum: "Proteobacteria" |
| Taxonomic ID (NCBI) | 637910 |
| Genome Information | |
| Gene Bank | FN543503 |
| EMBL | FN543503 |
| Gene Information | |
| Gene Name | ROD_p1111 |
| NCBI Reference Sequence | FN543503 |
| Protein information | |
| Protein Name | BAHTCr |
| UniProtKB/ SwissProt ID | D2TV87 |
| NCBI Ref Seq | WP_012908907.1 |
| UniProtKB Sequence | >tr|D2TV87|D2TV87_CITRI Putative adhesin glycosyltransferase OS=Citrobacter rodentium (strain ICC168) GN=ROD_p1111 PE=4 SV=1 MQKSLATFFISPPEIPTQHGPDNILYDFNDGARVLLPEGKWHVRLLDADSGNILFCCDIN NGWVTSSKKYFVRFRIQVFRQGEDSPLLDETLNLTDRDVLISFPTGTLGDLLGWFPYAER FQSLHQCRLECTMAQDIIDLLAPQYPQICFSTPEKPRTTEPYATYRVGLYFGGDTNNQPV DFRQVGFHRSAGYILGVDPREAPVRLNLSAPCTIREPYVCIATQSTCQAKYWNNGTGWSE VVAHLKSLGYRVLCIDREAHYGQGFVWNHIPWGAEDFTGSFPLQERVNLLRHASFFIGLA SGLSWLAWATGIPVVLISGFSLPDSEFYTPWRVFNSHGCNGCWDDTSLNFDHKDFLWCPR HKNTDRQFECTRLITGTQVNGVISRLHASLMKQGDKACLTKGTNNEQGL |
| EMBL CDS | CBG91773.1 |
| Sequence length | 409 AA |
| Additional Information | 1) BAHTCr, heptosyltransferases able complement AAH (E. coli) in restoring AIDA-I glycosylation and bacterial adhesion to HeLa cells. 2) BAHTCr is involved in a transfer of heptose to CARC autotransporter which is very critical for C. rodentium colonization in mice colon. |
| Glycosyltransferase Information | |
| Glycosylation Type | O- (Ser/Thr) linked |
| CAZY Family | GTNC |
| EC Number (BRENDA) | 2.4.1.- |
| Mechanism of Glycan Transfer | Sequential |
| Donor Type | Nucleotide activated sugars |
| Donor Specificity | ADP-Heptose |
| Glycan Information | |
| Glycan transferred | Monosaccharide (Heptose)Â |
| Method of Glycan Indentification | ECL glycoprotein detection kit |
| Experimental_strategies | In vivo and In vitro |
| Acceptor Subtrate Information | |
| Acceptor Substrate name | AIDA-I (CARC) |
| ProGPdb ID | ProGP201 |
| Acceptor Substrate name | TibA |
| ProGPdb ID | ProGP176 |
| Litrature | |
| Year Of Validation | 2014Â |
| Reference | Lu, Q., Yao, Q., Xu, Y., Li, L., Li, S., Liu, Y., Gao, W., Niu, M., Sharon, M., Ben-Nissan, G. & Zamyatina, A. (2014). An iron-containing dodecameric heptosyltransferase family modifies bacterial autotransporters in pathogenesis. Cell host & microbe, 16(3), 351-363. |
| Authors | Lu, Q., Yao, Q., Xu, Y., Li, L., Li, S., Liu, Y., Gao, W., Niu, M., Sharon, M., Ben-Nissan, G. & Zamyatina, A. |
| Research groups | 1 National Institute of Biological Sciences, Beijing 102206, China.National Institute of Biological Sciences, Beijing 102206, China. 2 College of Biological Sciences, China Agricultural University, Beijing 100094, China. 3 Institute of Analytical Chemistry & Synthetic and Functional Biomolecules Center. 4 College of Chemistry and Molecular Engineering, Peking University, Beijing 100871, China. 5 Department of Biological Chemistry, The Weizmann Institute of Science, Rehovot 76100, Israel. 6 Department of Chemistry, University of Natural Resources and Life Sciences, A-1190 Vienna, Austria. 7 National Institute of Biological Sciences, Beijing 102206, China. 8 National Laboratory of Biomacromolecules, Institute of Biophysics, Chinese Academy of Sciences, Beijing 100101, China. 9 National Institute of Biological Sciences, Beijing, Collaborative Innovation Center for Cancer Medicine, Beijing 102206, China. |
| Corresponding Author | Zamyatina, A. |
| Contacts | 1 National Institute of Biological Sciences, Beijing 102206, China. 2 National Laboratory of Biomacromolecules, Institute of Biophysics, Chinese Academy of Sciences, Beijing 100101, 3 China National Institute of Biological Sciences, Beijing, Collaborative Innovation Center for Cancer Medicine, Beijing 102206, China. |
| Reference | Yao, Q., Lu, Q., Wan, X., Song, F., Xu, Y., Hu, M., ... & Shao, F. (2014). A structural mechanism for bacterial autotransporter glycosylation by a dodecameric heptosyltransferase family. Elife, 3, e03714. |
| Authors | Yao, Q., Lu, Q., Wan, X., Song, F., Xu, Y., Hu, M., ... & Shao, F. |
| Research groups | 1 Dr Feng Shaos Laboratory, National Institute of Biological Sciences, Beijing, China. 2 Dr Niu Huangs Laboratory, National Institute of Biological Sciences, Beijing, China. 3 National Laboratory of Biomacromolecules, Institute of Biophysics, Chinese Academy of Sciences, Beijing, China. 4 Institute of Analytic Chemistry, College of Chemistry and Molecular Engineering, Peking University, Beijing, China. 5 Department of Chemistry, University of Natural Resources and Life Sciences, Vienna, Austria. |
| Corresponding Author | Shao, F. |
| Contacts | Dr Feng Shaos Laboratory, National Institute of Biological Sciences, Beijing, China |